Appdoc:Diffseq
From EMBOSS
Contents |
Function
Compare and report features of two similar sequences
Description
diffseq reads two sequences which typically are very similar or almost identical. It finds regions of overlap between the two sequences and reports on differences between the features of the two sequences within these regions. The output is a standard EMBOSS report file. The start and end positions of the regions of overlap are reported. Any differences between the sequences, and any features (except the source feature) that overlap those differences, are included in the output report.
The differences are also reported for each input sequence as two separate feature table output files.
Algorithm
diffseq searches for identical matches between all sequence words from both sequences. Identical sequence regions are found by creating a hash table of subsequences of user-defined size (-wordsize option), which is 10 by default. It then reduces the matches to a minimum set of overlapping matches by sorting them in order of size (largest size first). For each such match it removes any smaller matches that overlap. The result is a set of the longest regions of identity between the two sequences that do not overlap with each other. The mismatched regions between these matches are reported.
Usage
Here is a sample session with diffseq
% diffseq tembl:x65923 tembl:ay411291 Compare and report features of two similar sequences Word size [10]: Output report [x65923.diffseq]: Features output [X65923.diffgff]: Second features output [AY411291.diffgff]:
Go to the input files for this example
Go to the output files for this example
Command line arguments
| Qualifier | Type | Description | Allowed values | Default |
|---|---|---|---|---|
| Standard (Mandatory) qualifiers | ||||
| [-asequence] (Parameter 1) | sequence | Sequence filename and optional format, or reference (input USA) | Readable sequence | Required |
| [-bsequence] (Parameter 2) | sequence | Sequence filename and optional format, or reference (input USA) | Readable sequence | Required |
| -wordsize | integer | The similar regions between the two sequences are found by creating a hash table of 'wordsize'd subsequences. 10 is a reasonable default. Making this value larger (20?) may speed up the program slightly, but will mean that any two differences within 'wordsize' of each other will be grouped as a single region of difference. This value may be made smaller (4?) to improve the resolution of nearby differences, but the program will go much slower. | Integer 2 or more | 10 |
| [-outfile] (Parameter 3) | report | Output report file name | Report output file | <*>.diffseq |
| [-aoutfeat] (Parameter 4) | featout | File for output of first sequence's features | Writeable feature table | $(asequence.name).diffgff |
| [-boutfeat] (Parameter 5) | featout | File for output of second sequence's features | Writeable feature table | $(bsequence.name).diffgff |
| Additional (Optional) qualifiers | ||||
| -globaldifferences | boolean | Normally this program will find regions of identity that are the length of the specified word-size or greater and will then report the regions of difference between these matching regions. This works well and is what most people want if they are working with long overlapping nucleic acid sequences. You are usually not interested in the non-overlapping ends of these sequences. If you have protein sequences or short RNA sequences however, you will be interested in differences at the very ends . It this option is set to be true then the differences at the ends will also be reported. | Boolean value Yes/No | No |
| Advanced (Unprompted) qualifiers | ||||
| (none) | ||||
| Associated qualifiers | ||||
| "-asequence" associated sequence qualifiers | ||||
| -sbegin1 -sbegin_asequence | integer | Start of the sequence to be used | Any integer value | 0 |
| -send1 -send_asequence | integer | End of the sequence to be used | Any integer value | 0 |
| -sreverse1 -sreverse_asequence | boolean | Reverse (if DNA) | Boolean value Yes/No | N |
| -sask1 -sask_asequence | boolean | Ask for begin/end/reverse | Boolean value Yes/No | N |
| -snucleotide1 -snucleotide_asequence | boolean | Sequence is nucleotide | Boolean value Yes/No | N |
| -sprotein1 -sprotein_asequence | boolean | Sequence is protein | Boolean value Yes/No | N |
| -slower1 -slower_asequence | boolean | Make lower case | Boolean value Yes/No | N |
| -supper1 -supper_asequence | boolean | Make upper case | Boolean value Yes/No | N |
| -sformat1 -sformat_asequence | string | Input sequence format | Any string | |
| -sdbname1 -sdbname_asequence | string | Database name | Any string | |
| -sid1 -sid_asequence | string | Entryname | Any string | |
| -ufo1 -ufo_asequence | string | UFO features | Any string | |
| -fformat1 -fformat_asequence | string | Features format | Any string | |
| -fopenfile1 -fopenfile_asequence | string | Features file name | Any string | |
| "-bsequence" associated sequence qualifiers | ||||
| -sbegin2 -sbegin_bsequence | integer | Start of the sequence to be used | Any integer value | 0 |
| -send2 -send_bsequence | integer | End of the sequence to be used | Any integer value | 0 |
| -sreverse2 -sreverse_bsequence | boolean | Reverse (if DNA) | Boolean value Yes/No | N |
| -sask2 -sask_bsequence | boolean | Ask for begin/end/reverse | Boolean value Yes/No | N |
| -snucleotide2 -snucleotide_bsequence | boolean | Sequence is nucleotide | Boolean value Yes/No | N |
| -sprotein2 -sprotein_bsequence | boolean | Sequence is protein | Boolean value Yes/No | N |
| -slower2 -slower_bsequence | boolean | Make lower case | Boolean value Yes/No | N |
| -supper2 -supper_bsequence | boolean | Make upper case | Boolean value Yes/No | N |
| -sformat2 -sformat_bsequence | string | Input sequence format | Any string | |
| -sdbname2 -sdbname_bsequence | string | Database name | Any string | |
| -sid2 -sid_bsequence | string | Entryname | Any string | |
| -ufo2 -ufo_bsequence | string | UFO features | Any string | |
| -fformat2 -fformat_bsequence | string | Features format | Any string | |
| -fopenfile2 -fopenfile_bsequence | string | Features file name | Any string | |
| "-outfile" associated report qualifiers | ||||
| -rformat3 -rformat_outfile | string | Report format | Any string | diffseq |
| -rname3 -rname_outfile | string | Base file name | Any string | |
| -rextension3 -rextension_outfile | string | File name extension | Any string | |
| -rdirectory3 -rdirectory_outfile | string | Output directory | Any string | |
| -raccshow3 -raccshow_outfile | boolean | Show accession number in the report | Boolean value Yes/No | N |
| -rdesshow3 -rdesshow_outfile | boolean | Show description in the report | Boolean value Yes/No | N |
| -rscoreshow3 -rscoreshow_outfile | boolean | Show the score in the report | Boolean value Yes/No | Y |
| -rstrandshow3 -rstrandshow_outfile | boolean | Show the nucleotide strand in the report | Boolean value Yes/No | Y |
| -rusashow3 -rusashow_outfile | boolean | Show the full USA in the report | Boolean value Yes/No | N |
| -rmaxall3 -rmaxall_outfile | integer | Maximum total hits to report | Any integer value | 0 |
| -rmaxseq3 -rmaxseq_outfile | integer | Maximum hits to report for one sequence | Any integer value | 0 |
| "-aoutfeat" associated featout qualifiers | ||||
| -offormat4 -offormat_aoutfeat | string | Output feature format | Any string | |
| -ofopenfile4 -ofopenfile_aoutfeat | string | Features file name | Any string | |
| -ofextension4 -ofextension_aoutfeat | string | File name extension | Any string | |
| -ofdirectory4 -ofdirectory_aoutfeat | string | Output directory | Any string | |
| -ofname4 -ofname_aoutfeat | string | Base file name | Any string | |
| -ofsingle4 -ofsingle_aoutfeat | boolean | Separate file for each entry | Boolean value Yes/No | N |
| "-boutfeat" associated featout qualifiers | ||||
| -offormat5 -offormat_boutfeat | string | Output feature format | Any string | |
| -ofopenfile5 -ofopenfile_boutfeat | string | Features file name | Any string | |
| -ofextension5 -ofextension_boutfeat | string | File name extension | Any string | |
| -ofdirectory5 -ofdirectory_boutfeat | string | Output directory | Any string | |
| -ofname5 -ofname_boutfeat | string | Base file name | Any string | |
| -ofsingle5 -ofsingle_boutfeat | boolean | Separate file for each entry | Boolean value Yes/No | N |
| General qualifiers | ||||
| -auto | boolean | Turn off prompts | Boolean value Yes/No | N |
| -stdout | boolean | Write first file to standard output | Boolean value Yes/No | N |
| -filter | boolean | Read first file from standard input, write first file to standard output | Boolean value Yes/No | N |
| -options | boolean | Prompt for standard and additional values | Boolean value Yes/No | N |
| -debug | boolean | Write debug output to program.dbg | Boolean value Yes/No | N |
| -verbose | boolean | Report some/full command line options | Boolean value Yes/No | Y |
| -help | boolean | Report command line options. More information on associated and general qualifiers can be found with -help -verbose | Boolean value Yes/No | N |
| -warning | boolean | Report warnings | Boolean value Yes/No | Y |
| -error | boolean | Report errors | Boolean value Yes/No | Y |
| -fatal | boolean | Report fatal errors | Boolean value Yes/No | Y |
| -die | boolean | Report dying program messages | Boolean value Yes/No | Y |
Input file format
This program reads in two nucleic acid sequence USAs or two protein sequence USAs.
Input example
'tembl:x65923' is a sequence entry in the example nucleic acid database 'tembl'
Database entry: tembl:x65923
ID X65923; SV 1; linear; mRNA; STD; HUM; 518 BP.
XX
AC X65923;
XX
DT 13-MAY-1992 (Rel. 31, Created)
DT 18-APR-2005 (Rel. 83, Last updated, Version 11)
XX
DE H.sapiens fau mRNA
XX
KW fau gene.
XX
OS Homo sapiens (human)
OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC Homo.
XX
RN [1]
RP 1-518
RA Michiels L.M.R.;
RT ;
RL Submitted (29-APR-1992) to the EMBL/GenBank/DDBJ databases.
RL L.M.R. Michiels, University of Antwerp, Dept of Biochemistry,
RL Universiteisplein 1, 2610 Wilrijk, BELGIUM
XX
RN [2]
RP 1-518
RX PUBMED; 8395683.
RA Michiels L., Van der Rauwelaert E., Van Hasselt F., Kas K., Merregaert J.;
RT "fau cDNA encodes a ubiquitin-like-S30 fusion protein and is expressed as
RT an antisense sequence in the Finkel-Biskis-Reilly murine sarcoma virus";
RL Oncogene 8(9):2537-2546(1993).
XX
DR H-InvDB; HIT000322806.
XX
FH Key Location/Qualifiers
FH
FT source 1..518
FT /organism="Homo sapiens"
FT /chromosome="11q"
FT /map="13"
FT /mol_type="mRNA"
FT /clone_lib="cDNA"
FT /clone="pUIA 631"
FT /tissue_type="placenta"
FT /db_xref="taxon:9606"
FT misc_feature 57..278
FT /note="ubiquitin like part"
FT CDS 57..458
FT /gene="fau"
FT /db_xref="GDB:135476"
FT /db_xref="GOA:P62861"
FT /db_xref="HGNC:3597"
FT /db_xref="HSSP:1GJZ"
FT /db_xref="InterPro:IPR006846"
FT /db_xref="UniProtKB/Swiss-Prot:P35544"
FT /protein_id="CAA46716.1"
FT /translation="MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAG
FT APLEDEATLGQCGVEALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTG
FT RAKRRMQYNRRFVNVVPTFGKKKGPNANS"
FT misc_feature 98..102
FT /note="nucleolar localization signal"
FT misc_feature 279..458
FT /note="S30 part"
FT polyA_signal 484..489
FT polyA_site 509
XX
SQ Sequence 518 BP; 125 A; 139 C; 148 G; 106 T; 0 other;
ttcctctttc tcgactccat cttcgcggta gctgggaccg ccgttcagtc gccaatatgc 60
agctctttgt ccgcgcccag gagctacaca ccttcgaggt gaccggccag gaaacggtcg 120
cccagatcaa ggctcatgta gcctcactgg agggcattgc cccggaagat caagtcgtgc 180
tcctggcagg cgcgcccctg gaggatgagg ccactctggg ccagtgcggg gtggaggccc 240
tgactaccct ggaagtagca ggccgcatgc ttggaggtaa agttcatggt tccctggccc 300
gtgctggaaa agtgagaggt cagactccta aggtggccaa acaggagaag aagaagaaga 360
agacaggtcg ggctaagcgg cggatgcagt acaaccggcg ctttgtcaac gttgtgccca 420
cctttggcaa gaagaagggc cccaatgcca actcttaagt cttttgtaat tctggctttc 480
tctaataaaa aagccactta gttcagtcaa aaaaaaaa 518
//
Database entry: tembl:ay411291
ID AY411291; SV 1; linear; genomic DNA; GSS; HUM; 402 BP.
XX
AC AY411291;
XX
DT 13-DEC-2003 (Rel. 78, Created)
DT 17-DEC-2003 (Rel. 78, Last updated, Version 2)
XX
DE Homo sapiens FAU gene, VIRTUAL TRANSCRIPT, partial sequence, genomic survey
DE sequence.
XX
KW GSS.
XX
OS Homo sapiens (human)
OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC Homo.
XX
RN [1]
RP 1-402
RX DOI; 10.1126/science.1088821.
RX PUBMED; 14671302.
RA Clark A.G., Glanowski S., Nielson R., Thomas P., Kejariwal A., Todd M.A.,
RA Tanenbaum D.M., Civello D.R., Lu F., Murphy B., Ferriera S., Wang G.,
RA Zheng X.H., White T.J., Sninsky J.J., Adams M.D., Cargill M.;
RT "Inferring nonneutral evolution from human-chimp-mouse orthologous gene
RT trios";
RL Science 302(5652):1960-1963(2003).
XX
RN [2]
RP 1-402
RA Clark A.G., Glanowski S., Nielson R., Thomas P., Kejariwal A., Todd M.A.,
RA Tanenbaum D.M., Civello D.R., Lu F., Murphy B., Ferriera S., Wang G.,
RA Zheng X.H., White T.J., Sninsky J.J., Adams M.D., Cargill M.;
RT ;
RL Submitted (16-NOV-2003) to the EMBL/GenBank/DDBJ databases.
RL Celera Genomics, 45 West Gude Drive, Rockville, MD 20850, USA
XX
CC This sequence was made by sequencing genomic exons and ordering
CC them based on alignment.
XX
FH Key Location/Qualifiers
FH
FT source 1..402
FT /organism="Homo sapiens"
FT /mol_type="genomic DNA"
FT /db_xref="taxon:9606"
FT gene <1..>402
FT /gene="FAU"
FT /locus_tag="HCM4175"
XX
SQ Sequence 402 BP; 95 A; 110 C; 129 G; 68 T; 0 other;
atgcagctct ttgtccgcgc ccaggagcta cacaccttcg aggtgaccgg ccaggaaacg 60
gtcgcccaga tcaaggctca tgtagcctca ctggagggca ttgccccgga agatcaagtc 120
gtgctcctgg caggcgcgcc cctggaggat gaggccactc tgggccagtg cggggtggag 180
gccctgacta ccctggaagt agcaggccgc atgcttggag gtaaagtcca tggttccctg 240
gcccgtgctg gaaaagtgag aggtcagact cctaaggtgg ccaaacagga gaagaagaag 300
aagaagacag gtcgggctaa gcggcggatg cagtacaacc ggcgctttgt caacgttgtg 360
cccacctttg gcaagaagaa gggccccaat gccaactctt aa 402
//
Output file format
The output is a standard EMBOSS report file.
The results can be output in one of several styles by using the command-line qualifier -rformat xxx, where 'xxx' is replaced by the name of the required format. The available format names are: embl, genbank, gff, pir, swiss, trace, listfile, dbmotif, diffseq, excel, feattable, motif, regions, seqtable, simple, srs, table, tagseq
See: ReportFormats for further information on report formats.
By default diffseq writes a 'diffseq' report file.
Output example
File: x65923.diffseq
######################################## # Program: diffseq # Rundate: Wed 15 Jul 2009 12:00:00 # Commandline: diffseq # [-asequence] tembl:x65923 # [-bsequence] tembl:ay411291 # Report_format: diffseq # Report_file: x65923.diffseq # Additional_files: 2 # 1: X65923.diffgff (Feature file for first sequence) # 2: AY411291.diffgff (Feature file for second sequence) ######################################## #======================================= # # Sequence: X65923 from: 1 to: 518 # HitCount: 1 # # Compare: AY411291 from: 1 to: 402 # # X65923 overlap starts at 57 # AY411291 overlap starts at 1 # # #======================================= X65923 284-284 Length: 1 Feature: CDS 57-458 gene='fau' db_xref='GDB:135476' db_xref='GOA:P62861' db_xref='HGNC:3597' db_xref='HSSP:1GJZ' db_xref='InterPro:IPR006846' db_xref='UniProtKB/Swiss-Prot:P35544' protein_id='CAA46716.1' Feature: misc_feature 279-458 note='S30 part' Sequence: t Sequence: c Feature: gene 1-402 gene='FAU' locus_tag='HCM4175' AY411291 228-228 Length: 1 #--------------------------------------- # # Overlap_end: 458 in X65923 # Overlap_end: 402 in AY411291 # # SNP_count: 1 # Transitions: 1 # Transversions: 0 # #--------------------------------------- #--------------------------------------- # Total_sequences: 2 # Total_length: 920 # Reported_sequences: 1 # Reported_hitcount: 1 #---------------------------------------
File: AY411291.diffgff
##gff-version 3 ##sequence-region AY411291 1 402 #!Date 2009-07-15 #!Type DNA #!Source-version EMBOSS 6.1.0 AY411291 diffseq sequence_conflict 228 228 1.000 + . ID="AY411291.1";note="SNP in X65923";replace="t"
File: X65923.diffgff
##gff-version 3 ##sequence-region X65923 1 518 #!Date 2009-07-15 #!Type DNA #!Source-version EMBOSS 6.1.0 X65923 diffseq sequence_conflict 284 284 1.000 + . ID="X65923.1";note="SNP in AY411291";replace="c"
The first line is the title giving the names of the sequences used.
The next two non-blank lines state the positions in each sequence where the detected overlap between them starts.
There then follows a set of reports of the mismatches between the sequences.
Each report consists of 4 or more lines.
- The first line has the name of the first sequence followed by the start and end positions of the mismatched region in that sequence, followed by the length of the mismatched region. If the mismatched region is of zero length in this sequence, then only the position of the last matching base before the mismatch is given.</li>
- If a feature of the first sequence overlaps with this mismatch region, then one or more lines starting with 'Feature:' comes next with the type, position and tag field of the feature.</li>
- Next is a line starting "Sequence:" giving the sequence of the
mismatch in the first sequence.</li>
This is followed by the equivalent information for the second sequence, but in the reverse order, namely 'Sequence:' line, 'Feature:' lines and line giving the position of the mismatch in the second sequence.
At the end of the report are two non-blank lines giving the positions in each sequence where the detected overlap between them ends.
The last three lines of the report gives the counts of SNPs (defined as a change of one nucleotide to one other nucleotide, no deletions or insertions are counted, no multi-base changes are counted).
If the input sequences are nucleic acid, The counts of transitions (Pyrimide to Pyrimidine or Purine to Purine) and transversions (Pyrimidine to Purine) are also given.
It should be noted that not all features are reported.
The 'source' feature found in all EMBL/Genbank feature table entries is not reported as this covers all of the sequence and so overlaps with any difference found in that sequence and so is uninformative and irritating. It has therefore been removed from the output report.
The translation information of CDS features is often extremely long and does not add useful information to the report. It has therefore been removed from the output report.
Data files
None
Notes
diffseq is useful when looking for SNPs, differences between strains of an organism and anything else that requires the differences between two eseentially identical sequences to be highlighted.
Identical sequence regions are found by creating a hash table of subsequences of user-defined size (-wordsize option, which is 10 by default). Making this value larger (e.g. 20) may speed-up the program slightly, but will mean that any two differences within wordsize bases bases or residues of each other will be grouped as a single region of difference. This value may be made smaller to improve the resolution of nearby differences, but the program will go much slower.
The sequences can be very long; it should be possible to find differences between sequences that are Mega-bases long. If, however, you run out of memory, use a larger word size. This increases the length between mismatches that will be reported as one event. Thus a word size of 50 will report two single-base differences that are with 50 bases of each other as one mismatch.
By default, diffseq finds regions of identity that are at least as long as the specified word-size. This is what is typically required when working with long overlapping nucleic acid sequences, where the non-overlapping sequence ends are less interesting. If however, you have protein sequences or short RNA sequences then you may well be interested in differences at the very ends. The -globaldifferences option when set means the differences at the ends will also be reported.
References
None.
Warnings
None.
Diagnostic Error Messages
None.
Exit status
It always exits with status 0.
Known bugs
None.
See also
Author(s)
Gary Williams formerly at MRC Rosalind Franklin Centre for Genomics Research Wellcome Trust Genome Campus, Hinxton, Cambridge, CB10 1SB, UK
Please report all bugs to the EMBOSS bug team (emboss-bug (@) emboss.open-bio.org) not to the original author.
History
Written 15th Aug 2000 - Gary Williams.
18th Aug 2000 - Added writing out GFF files of the mismatched regions
Target users
This program is intended to be used by everyone and everything, from naive users to embedded scripts.
Comments
None

