|   | banana | 
Please help by correcting and extending the Wiki pages.
banana predicts bending of a normal (B) DNA double helix, using the method of Goodsell & Dickerson, NAR 1994 11;22(24):5497-5503. The program calculates the magnitude of local bending and macroscopic curvature at each point along an arbitrary B-DNA sequence, using any desired bending model that specifies values of twist, roll and tilt as a function of sequence. The program outputs both a graphical display and a text file of the results.
The default model (model 'a' from the Goodsell & Dickerson paper) is based on the nucleosome positioning data of Satchwell et al 1986 (J. Mol. Biol. 191, 659-675). It correctly predicts experimental A-tract curvature as measured by gel retardation and cyclization kinetics and successfully predicts curvature in regions containing phased GGGCCC sequences. The model shows local bending at mixed sequence DNA, strong bends at the sequence GGC, and straight, rigid A-tracts. It is the only model out of the six investigated that is consistent with both solution data from gel retardation and cyclization kinetics and structural data from x-ray crystallography.
banana reads a sequence and a matrix of standard twist, roll and tilt angles for each type of base pair step. The default matrix is described below (see "Bending Model") but some other can be specified (see "Data Files" below). The program creates a table or a graphical image of the bending and the curvature at each base step.
The indicated twist, roll and tilt angles are applied at each step along the sequence, and the resulting base pair normal vector calculated. The first base pair is aligned normal to the z axis, with a twist value of 0.0 degrees. The specified twist is applied to the second base pair, and roll and tilt values are use to calculate its normal vector relative to the first. If either roll or tilt is non-zero, the new normal vector will be angled away from the z axis, producing the first 'bend'. The process is continued along the sequence, applying the appropriate twist, roll and tilt to each new base pair relative to its predecessor. The result is a list of normal vectors for all base pairs in the sequence.
Local bends are then calculated from the normal vectors. The bend for base N is calculated across a window from N-1 to N+1.
Curvature is calculated in two steps. Base pair normals are first averaged over a 10-base-pair window to filter out the local writhing of the helix. The normals of the nine base pairs from N-4 to N+4, and the two base pairs N-5 and N+5 at half weight, are averaged and assigned to base pair N. Curvature then is calculated from these averaged normal vector values, using a bracket value, nc, with a value of 15. That is, the curvature at base pair N is the angle between averaged normal vectors at base pairs N-nc and N+nc.
banana reads by default a data file (Eangles_tri.dat) of twist, roll and tilt angles, as in Goodsell & Dickerson, NAR 1994 11;22(24):5497-503 and Drew and Travers (1986) JMB 191, 659. The roll-tilt-twist parameters of this bending model are objective and unbiased. They are derived purely from experimental observations of sequence location preferences of base trimers in small circles of DNA, without reference to solution techniques that measure curvature per se.
Satchwell, Drew and Travers studied the positioning of DNA sequences wrappped around nucleosome cores, and in closed circles of double-helical DNA of comparable size. From the sequence data they calculated a fractional preference of each base pair triplet for a position 'facing out', or with the major groove on the concave side of the curved helix.
The sequence GGC, for example, has a 45% preference for locations on a bent double helix in which its major groove faces inward and is compressed by the curvature (tending towards positive roll), whereas sequence AAA has a 36% preference for the opposite orientation, with major groove facing outward and with minor groove facing inward and compressed (tending toward negative roll).
These fractional variances are converted into roll angles in the following manner: Because x-ray cyrstal structure analysis uniformly indicates that AA steps are unbent, a zero roll is assigned to the AAA triplet; an arbitrary maximum roll of 10 degrees is asigned to GGC, and all other triplets are scaled in a lenear manner. Where % is the percent-out figure, then: Roll = 10 degrees * (% + 36)/(45 + 36)
Changing the maximum roll value will scale the entire profile up or down proportionately, but will not change the shape of the profile. Peaks will remain peaks, and valleys, valleys. The absolute magnitude of all the roll values is less important than their relative magnitude, or the order of roll preference. Twist angles were set to zero. Because these values correspond to base trimers, the values of roll, tilt and twist were applied to the first two bases for the calculation.
| % banana -nooutfile -graph ps Plot bending and curvature data for B-DNA Input nucleotide sequence: tembl:u68037 Created banana.ps | 
Go to the input files for this example
Go to the output files for this example
Example 2
| % banana -graph data Plot bending and curvature data for B-DNA Input nucleotide sequence: tembl:u68037 Created banana1.dat Created banana2.dat Created banana3.dat Created banana4.dat Created banana5.dat Created banana6.dat Created banana7.dat Created banana8.dat Created banana9.dat | 
Go to the output files for this example
| 
Plot bending and curvature data for B-DNA
Version: EMBOSS:6.4.0.0
   Standard (Mandatory) qualifiers:
  [-sequence]          sequence   Nucleotide sequence filename and optional
                                  format, or reference (input USA)
   -graph              graph      [$EMBOSS_GRAPHICS value, or x11] Graph type
                                  (ps, hpgl, hp7470, hp7580, meta, cps, x11,
                                  tek, tekt, none, data, xterm, png, gif, pdf,
                                  svg)
   Additional (Optional) qualifiers:
   -anglesfile         datafile   [Eangles_tri.dat] DNA base trimer roll
                                  angles data file
   -residuesperline    integer    [50] Number of residues to be displayed on
                                  each line (Any integer value)
   -outfile            outfile    [banana.profile] Output file name
   Advanced (Unprompted) qualifiers: (none)
   Associated qualifiers:
   "-sequence" associated qualifiers
   -sbegin1            integer    Start of the sequence to be used
   -send1              integer    End of the sequence to be used
   -sreverse1          boolean    Reverse (if DNA)
   -sask1              boolean    Ask for begin/end/reverse
   -snucleotide1       boolean    Sequence is nucleotide
   -sprotein1          boolean    Sequence is protein
   -slower1            boolean    Make lower case
   -supper1            boolean    Make upper case
   -sformat1           string     Input sequence format
   -sdbname1           string     Database name
   -sid1               string     Entryname
   -ufo1               string     UFO features
   -fformat1           string     Features format
   -fopenfile1         string     Features file name
   "-graph" associated qualifiers
   -gprompt            boolean    Graph prompting
   -gdesc              string     Graph description
   -gtitle             string     Graph title
   -gsubtitle          string     Graph subtitle
   -gxtitle            string     Graph x axis title
   -gytitle            string     Graph y axis title
   -goutfile           string     Output file for non interactive displays
   -gdirectory         string     Output directory
   "-outfile" associated qualifiers
   -odirectory         string     Output directory
   General qualifiers:
   -auto               boolean    Turn off prompts
   -stdout             boolean    Write first file to standard output
   -filter             boolean    Read first file from standard input, write
                                  first file to standard output
   -options            boolean    Prompt for standard and additional values
   -debug              boolean    Write debug output to program.dbg
   -verbose            boolean    Report some/full command line options
   -help               boolean    Report command line options and exit. More
                                  information on associated and general
                                  qualifiers can be found with -help -verbose
   -warning            boolean    Report warnings
   -error              boolean    Report errors
   -fatal              boolean    Report fatal errors
   -die                boolean    Report dying program messages
   -version            boolean    Report version number and exit
 | 
| Qualifier | Type | Description | Allowed values | Default | 
|---|---|---|---|---|
| Standard (Mandatory) qualifiers | ||||
| [-sequence] (Parameter 1) | sequence | Nucleotide sequence filename and optional format, or reference (input USA) | Readable sequence | Required | 
| -graph | graph | Graph type | EMBOSS has a list of known devices, including ps, hpgl, hp7470, hp7580, meta, cps, x11, tek, tekt, none, data, xterm, png, gif, pdf, svg | EMBOSS_GRAPHICS value, or x11 | 
| Additional (Optional) qualifiers | ||||
| -anglesfile | datafile | DNA base trimer roll angles data file | Data file | Eangles_tri.dat | 
| -residuesperline | integer | Number of residues to be displayed on each line | Any integer value | 50 | 
| -outfile | outfile | Output file name | Output file | banana.profile | 
| Advanced (Unprompted) qualifiers | ||||
| (none) | ||||
| Associated qualifiers | ||||
| "-sequence" associated sequence qualifiers | ||||
| -sbegin1 -sbegin_sequence | integer | Start of the sequence to be used | Any integer value | 0 | 
| -send1 -send_sequence | integer | End of the sequence to be used | Any integer value | 0 | 
| -sreverse1 -sreverse_sequence | boolean | Reverse (if DNA) | Boolean value Yes/No | N | 
| -sask1 -sask_sequence | boolean | Ask for begin/end/reverse | Boolean value Yes/No | N | 
| -snucleotide1 -snucleotide_sequence | boolean | Sequence is nucleotide | Boolean value Yes/No | N | 
| -sprotein1 -sprotein_sequence | boolean | Sequence is protein | Boolean value Yes/No | N | 
| -slower1 -slower_sequence | boolean | Make lower case | Boolean value Yes/No | N | 
| -supper1 -supper_sequence | boolean | Make upper case | Boolean value Yes/No | N | 
| -sformat1 -sformat_sequence | string | Input sequence format | Any string | |
| -sdbname1 -sdbname_sequence | string | Database name | Any string | |
| -sid1 -sid_sequence | string | Entryname | Any string | |
| -ufo1 -ufo_sequence | string | UFO features | Any string | |
| -fformat1 -fformat_sequence | string | Features format | Any string | |
| -fopenfile1 -fopenfile_sequence | string | Features file name | Any string | |
| "-graph" associated graph qualifiers | ||||
| -gprompt | boolean | Graph prompting | Boolean value Yes/No | N | 
| -gdesc | string | Graph description | Any string | Bending and curvature plot | 
| -gtitle | string | Graph title | Any string | |
| -gsubtitle | string | Graph subtitle | Any string | |
| -gxtitle | string | Graph x axis title | Any string | |
| -gytitle | string | Graph y axis title | Any string | |
| -goutfile | string | Output file for non interactive displays | Any string | |
| -gdirectory | string | Output directory | Any string | |
| "-outfile" associated outfile qualifiers | ||||
| -odirectory | string | Output directory | Any string | |
| General qualifiers | ||||
| -auto | boolean | Turn off prompts | Boolean value Yes/No | N | 
| -stdout | boolean | Write first file to standard output | Boolean value Yes/No | N | 
| -filter | boolean | Read first file from standard input, write first file to standard output | Boolean value Yes/No | N | 
| -options | boolean | Prompt for standard and additional values | Boolean value Yes/No | N | 
| -debug | boolean | Write debug output to program.dbg | Boolean value Yes/No | N | 
| -verbose | boolean | Report some/full command line options | Boolean value Yes/No | Y | 
| -help | boolean | Report command line options and exit. More information on associated and general qualifiers can be found with -help -verbose | Boolean value Yes/No | N | 
| -warning | boolean | Report warnings | Boolean value Yes/No | Y | 
| -error | boolean | Report errors | Boolean value Yes/No | Y | 
| -fatal | boolean | Report fatal errors | Boolean value Yes/No | Y | 
| -die | boolean | Report dying program messages | Boolean value Yes/No | Y | 
| -version | boolean | Report version number and exit | Boolean value Yes/No | N | 
The output is a standard EMBOSS sequence file.
The results can be output in one of several styles by using the command-line qualifier -osformat xxx, where 'xxx' is replaced by the name of the required format. The available format names are: embl, genbank, gff, pir, swiss, dasgff, debug, listfile, dbmotif, diffseq, excel, feattable, motif, nametable, regions, seqtable, simple, srs, table, tagseq.
See: http://emboss.sf.net/docs/themes/SequenceFormats.html for further information on sequence formats.
| 
ID   U68037; SV 1; linear; mRNA; STD; ROD; 1218 BP.
XX
AC   U68037;
XX
DT   23-SEP-1996 (Rel. 49, Created)
DT   04-MAR-2000 (Rel. 63, Last updated, Version 2)
XX
DE   Rattus norvegicus EP1 prostanoid receptor mRNA, complete cds.
XX
KW   .
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Rattus.
XX
RN   [1]
RP   1-1218
RA   Abramovitz M., Boie Y.;
RT   "Cloning of the rat EP1 prostanoid receptor";
RL   Unpublished.
XX
RN   [2]
RP   1-1218
RA   Abramovitz M., Boie Y.;
RT   ;
RL   Submitted (26-AUG-1996) to the EMBL/GenBank/DDBJ databases.
RL   Biochemistry & Molecular Biology, Merck Frosst Center for Therapeutic
RL   Research, P. O. Box 1005, Pointe Claire - Dorval, Quebec H9R 4P8, Canada
XX
DR   Ensembl-GO; ENSRNOESTG00000830631; Rattus_norvegicus.
DR   Ensembl-Gn; ENSRNOG00000004094; Rattus_norvegicus.
DR   Ensembl-Gn; ENSRNOG00000017743; Rattus_norvegicus.
DR   Ensembl-TO; ENSRNOESTT00000830623; Rattus_norvegicus.
DR   Ensembl-Tr; ENSRNOT00000005470; Rattus_norvegicus.
DR   Ensembl-Tr; ENSRNOT00000023860; Rattus_norvegicus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1218
FT                   /organism="Rattus norvegicus"
FT                   /strain="Sprague-Dawley"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10116"
FT   CDS             1..1218
FT                   /codon_start=1
FT                   /product="EP1 prostanoid receptor"
FT                   /note="family 1 G-protein coupled receptor"
FT                   /db_xref="GOA:P70597"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000708"
FT                   /db_xref="InterPro:IPR001244"
FT                   /db_xref="InterPro:IPR008365"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/Swiss-Prot:P70597"
FT                   /protein_id="AAB07735.1"
FT                   /translation="MSPYGLNLSLVDEATTCVTPRVPNTSVVLPTGGNGTSPALPIFSM
FT                   TLGAVSNVLALALLAQVAGRLRRRRSTATFLLFVASLLAIDLAGHVIPGALVLRLYTAG
FT                   RAPAGGACHFLGGCMVFFGLCPLLLGCGMAVERCVGVTQPLIHAARVSVARARLALALL
FT                   AAMALAVALLPLVHVGHYELQYPGTWCFISLGPPGGWRQALLAGLFAGLGLAALLAALV
FT                   CNTLSGLALLRARWRRRRSRRFRENAGPDDRRRWGSRGLRLASASSASSITSTTAALRS
FT                   SRGGGSARRVHAHDVEMVGQLVGIMVVSCICWSPLLVLVVLAIGGWNSNSLQRPLFLAV
FT                   RLASWNQILDPWVYILLRQAMLRQLLRLLPLRVSAKGGPTELSLTKSAWEASSLRSSRH
FT                   SGFSHL"
XX
SQ   Sequence 1218 BP; 162 A; 397 C; 387 G; 272 T; 0 other;
     atgagcccct acgggcttaa cctgagccta gtggatgagg caacaacgtg tgtaacaccc        60
     agggtcccca atacatctgt ggtgctgcca acaggcggta acggcacatc accagcgctg       120
     cctatcttct ccatgacgct gggtgctgtg tccaacgtgc tggcgctggc gctgctggcc       180
     caggttgcag gcagactgcg gcgccgccgc tcgactgcca ccttcctgtt gttcgtcgcc       240
     agcctgcttg ccatcgacct agcaggccat gtgatcccgg gcgccttggt gcttcgcctg       300
     tatactgcag gacgtgcgcc cgctggcggg gcctgtcatt tcctgggcgg ctgtatggtc       360
     ttctttggcc tgtgcccact tttgcttggc tgtggcatgg ccgtggagcg ctgcgtgggt       420
     gtcacgcagc cgctgatcca cgcggcgcgc gtgtccgtag cccgcgcacg cctggcacta       480
     gccctgctgg ccgccatggc tttggcagtg gcgctgctgc cactagtgca cgtgggtcac       540
     tacgagctac agtaccctgg cacttggtgt ttcattagcc ttgggcctcc tggaggttgg       600
     cgccaggcgt tgcttgcggg cctcttcgcc ggccttggcc tggctgcgct ccttgccgca       660
     ctagtgtgta atacgctcag cggcctggcg ctccttcgtg cccgctggag gcggcgtcgc       720
     tctcgacgtt tccgagagaa cgcaggtccc gatgatcgcc ggcgctgggg gtcccgtgga       780
     ctccgcttgg cctccgcctc gtctgcgtca tccatcactt caaccacagc tgccctccgc       840
     agctctcggg gaggcggctc cgcgcgcagg gttcacgcac acgacgtgga aatggtgggc       900
     cagctcgtgg gcatcatggt ggtgtcgtgc atctgctgga gccccctgct ggtattggtg       960
     gtgttggcca tcgggggctg gaactctaac tccctgcagc ggccgctctt tctggctgta      1020
     cgcctcgcgt cgtggaacca gatcctggac ccatgggtgt acatcctgct gcgccaggct      1080
     atgctgcgcc aacttcttcg cctcctaccc ctgagggtta gtgccaaggg tggtccaacg      1140
     gagctgagcc taaccaagag tgcctgggag gccagttcac tgcgtagctc ccggcacagt      1200
     ggcttcagcc acttgtga                                                    1218
//
 | 
The graphical display shows the sequence together with the local local bending (solid line) and macroscopic curvature (dotted line).
The output is to the specified graphics device.
The results can be output in one of several formats by using the command-line qualifier -graph xxx, where 'xxx' is replaced by the name of the required device. Support depends on the availability of third-party software packages.
The device names that output to a file are: ps (postscript), cps (colourps), png, gif, pdf, svg, hpgl, hp7470, hp7580, das, data.
The other available device names are: meta, x11 (xwindows), tek (tek4107t), tekt (tektronix), xterm, text.
Output can be turned off by specifying none (null).
See: http://emboss.sf.net/docs/themes/GraphicsDevices.html for further information on supported devices.
| Base Bend Curve a 0.0 0.0 t 19.7 0.0 g 17.7 0.0 a 21.1 0.0 g 28.5 0.0 c 26.2 0.0 c 19.7 0.0 c 18.7 0.0 c 12.5 0.0 t 9.7 0.0 a 14.9 0.0 c 16.5 0.0 g 17.5 0.0 g 26.2 0.0 g 28.5 0.0 c 20.7 0.0 t 11.7 0.0 t 6.4 0.0 a 9.3 0.0 a 14.9 0.0 c 17.7 20.0 c 15.7 19.2 t 15.7 18.5 g 17.7 17.9 a 21.1 17.1 g 28.5 15.9 c 25.2 14.6 c 12.5 13.3 t 7.2 11.9 a 13.2 10.8 g 20.1 10.1 t 19.5 9.6 g 15.1 9.2 g 14.9 9.1 a 19.5 9.5 t 19.7 10.2 g 17.7 10.8 a 17.7 11.0 g 25.2 11.2 g 26.2 11.3 c 15.3 11.5 a 11.4 11.7 a 14.5 12.0 c 13.9 12.2 a 11.4 12.3 a 14.9 12.5 c 17.7 12.8 g 19.5 13.3 t 19.1 13.5 [Part of this file has been deleted for brevity] g 15.1 15.2 a 17.7 15.5 g 25.2 15.8 g 32.5 16.0 c 25.2 15.8 c 15.7 15.0 a 16.3 14.2 g 15.5 13.5 t 10.8 12.8 t 13.7 12.3 c 19.5 12.1 a 20.1 12.1 c 16.3 12.1 t 16.7 11.9 g 22.1 11.4 c 21.1 11.1 g 14.9 10.7 t 9.7 10.3 a 16.1 9.8 g 24.5 9.4 c 21.1 8.9 t 15.1 8.4 c 16.1 7.7 c 17.5 7.3 c 15.3 6.9 g 24.0 6.4 g 26.2 5.8 c 20.5 5.4 a 19.1 5.1 c 15.3 26.0 a 16.3 0.0 g 20.1 0.0 t 19.5 0.0 g 25.2 0.0 g 28.5 0.0 c 20.7 0.0 t 13.3 0.0 t 13.7 0.0 c 15.7 0.0 a 19.1 0.0 g 28.5 0.0 c 25.2 0.0 c 19.5 0.0 a 20.1 0.0 c 17.9 0.0 t 13.9 0.0 t 13.9 0.0 g 19.1 0.0 t 19.5 0.0 g 0.0 0.0 a 0.0 0.0 | 
| ##Maintitle Bending and curvature plot of tembl-id:U68037 ##Subtitle Fri 15 Jul 2011 12:00:00 ##Graphic ##Screen x1 -1.000000 y1 0.000000 x2 60.000000 y2 80.000000 Text3 x1 3.000000 y1 56.099998 colour 0 size 9.600000 a Line x1 2.500000 y1 59.879997 x2 3.500000 y2 59.879997 colour 0 Text3 x1 4.000000 y1 56.099998 colour 0 size 9.600000 t Line x1 3.500000 y1 66.743378 x2 4.500000 y2 66.039978 colour 0 Line x1 3.500000 y1 59.879997 x2 4.500000 y2 59.879997 colour 0 Text3 x1 5.000000 y1 56.099998 colour 0 size 9.600000 g Line x1 4.500000 y1 66.039978 x2 5.500000 y2 67.239143 colour 0 Line x1 4.500000 y1 59.879997 x2 5.500000 y2 59.879997 colour 0 Text3 x1 6.000000 y1 56.099998 colour 0 size 9.600000 a Line x1 5.500000 y1 67.239143 x2 6.500000 y2 69.829361 colour 0 Line x1 5.500000 y1 59.879997 x2 6.500000 y2 59.879997 colour 0 Text3 x1 7.000000 y1 56.099998 colour 0 size 9.600000 g Line x1 6.500000 y1 69.829361 x2 7.500000 y2 69.006195 colour 0 Line x1 6.500000 y1 59.879997 x2 7.500000 y2 59.879997 colour 0 Text3 x1 8.000000 y1 56.099998 colour 0 size 9.600000 c Line x1 7.500000 y1 69.006195 x2 8.500000 y2 66.739983 colour 0 Line x1 7.500000 y1 59.879997 x2 8.500000 y2 59.879997 colour 0 Text3 x1 9.000000 y1 56.099998 colour 0 size 9.600000 c Line x1 8.500000 y1 66.739983 x2 9.500000 y2 66.390877 colour 0 Line x1 8.500000 y1 59.879997 x2 9.500000 y2 59.879997 colour 0 Text3 x1 10.000000 y1 56.099998 colour 0 size 9.600000 c Line x1 9.500000 y1 66.390877 x2 10.500000 y2 64.256180 colour 0 Line x1 9.500000 y1 59.879997 x2 10.500000 y2 59.879997 colour 0 Text3 x1 11.000000 y1 56.099998 colour 0 size 9.600000 c Line x1 10.500000 y1 64.256180 x2 11.500000 y2 63.249973 colour 0 Line x1 10.500000 y1 59.879997 x2 11.500000 y2 59.879997 colour 0 Text3 x1 12.000000 y1 56.099998 colour 0 size 9.600000 t Line x1 11.500000 y1 63.249973 x2 12.500000 y2 65.068802 colour 0 Line x1 11.500000 y1 59.879997 x2 12.500000 y2 59.879997 colour 0 Text3 x1 13.000000 y1 56.099998 colour 0 size 9.600000 a Line x1 12.500000 y1 65.068802 x2 13.500000 y2 65.621445 colour 0 Line x1 12.500000 y1 59.879997 x2 13.500000 y2 59.879997 colour 0 Text3 x1 14.000000 y1 56.099998 colour 0 size 9.600000 c Line x1 13.500000 y1 65.621445 x2 14.500000 y2 65.974617 colour 0 Line x1 13.500000 y1 59.879997 x2 14.500000 y2 59.879997 colour 0 Text3 x1 15.000000 y1 56.099998 colour 0 size 9.600000 g Line x1 14.500000 y1 65.974617 x2 15.500000 y2 69.006195 colour 0 Line x1 14.500000 y1 59.879997 x2 15.500000 y2 59.879997 colour 0 Text3 x1 16.000000 y1 56.099998 colour 0 size 9.600000 g Line x1 15.500000 y1 69.006195 x2 16.500000 y2 69.829361 colour 0 Line x1 15.500000 y1 59.879997 x2 16.500000 y2 59.879997 colour 0 Text3 x1 17.000000 y1 56.099998 colour 0 size 9.600000 g Line x1 16.500000 y1 69.829361 x2 17.500000 y2 67.101654 colour 0 Line x1 16.500000 y1 59.879997 x2 17.500000 y2 59.879997 colour 0 Text3 x1 18.000000 y1 56.099998 colour 0 size 9.600000 c Line x1 17.500000 y1 67.101654 x2 18.500000 y2 63.978649 colour 0 [Part of this file has been deleted for brevity] Line x1 39.500000 y1 30.619974 x2 40.500000 y2 28.755508 colour 0 Line x1 39.700001 y1 23.003500 x2 40.299999 y2 23.142790 colour 0 Line x1 39.500000 y1 22.079996 x2 40.500000 y2 22.079996 colour 0 Text3 x1 41.000000 y1 18.299995 colour 0 size 9.600000 c Line x1 40.500000 y1 28.755508 x2 41.500000 y2 27.544254 colour 0 Line x1 40.700001 y1 23.142790 x2 41.299999 y2 23.373348 colour 0 Line x1 40.500000 y1 22.079996 x2 41.500000 y2 22.079996 colour 0 Text3 x1 42.000000 y1 18.299995 colour 0 size 9.600000 t Line x1 41.500000 y1 27.544254 x2 42.500000 y2 28.590874 colour 0 Line x1 41.700001 y1 23.373348 x2 42.299999 y2 23.594353 colour 0 Line x1 41.500000 y1 22.079996 x2 42.500000 y2 22.079996 colour 0 Text3 x1 43.000000 y1 18.299995 colour 0 size 9.600000 g Line x1 42.500000 y1 28.590874 x2 43.500000 y2 28.590874 colour 0 Line x1 42.700001 y1 23.594353 x2 43.299999 y2 23.768497 colour 0 Line x1 42.500000 y1 22.079996 x2 43.500000 y2 22.079996 colour 0 Text3 x1 44.000000 y1 18.299995 colour 0 size 9.600000 g Line x1 43.500000 y1 28.590874 x2 44.500000 y2 28.872763 colour 0 Line x1 43.700001 y1 23.768497 x2 44.299999 y2 23.897196 colour 0 Line x1 43.500000 y1 22.079996 x2 44.500000 y2 22.079996 colour 0 Text3 x1 45.000000 y1 18.299995 colour 0 size 9.600000 g Line x1 44.500000 y1 28.872763 x2 45.500000 y2 29.220501 colour 0 Line x1 44.700001 y1 23.897196 x2 45.299999 y2 23.947050 colour 0 Line x1 44.500000 y1 22.079996 x2 45.500000 y2 22.079996 colour 0 Text3 x1 46.000000 y1 18.299995 colour 0 size 9.600000 t Line x1 45.500000 y1 29.220501 x2 46.500000 y2 29.784340 colour 0 Line x1 45.700001 y1 23.947050 x2 46.299999 y2 23.960222 colour 0 Line x1 45.500000 y1 22.079996 x2 46.500000 y2 22.079996 colour 0 Text3 x1 47.000000 y1 18.299995 colour 0 size 9.600000 g Line x1 46.500000 y1 29.784340 x2 47.500000 y2 28.755508 colour 0 Line x1 46.700001 y1 23.960222 x2 47.299999 y2 23.933397 colour 0 Line x1 46.500000 y1 22.079996 x2 47.500000 y2 22.079996 colour 0 Text3 x1 48.000000 y1 18.299995 colour 0 size 9.600000 c Line x1 47.500000 y1 28.755508 x2 48.500000 y2 27.402788 colour 0 Line x1 47.700001 y1 23.933397 x2 48.299999 y2 23.842731 colour 0 Line x1 47.500000 y1 22.079996 x2 48.500000 y2 22.079996 colour 0 Text3 x1 49.000000 y1 18.299995 colour 0 size 9.600000 t Line x1 48.500000 y1 27.402788 x2 49.500000 y2 28.734222 colour 0 Line x1 48.700001 y1 23.842731 x2 49.299999 y2 23.635277 colour 0 Line x1 48.500000 y1 22.079996 x2 49.500000 y2 22.079996 colour 0 Text3 x1 50.000000 y1 18.299995 colour 0 size 9.600000 g Line x1 49.500000 y1 28.734222 x2 50.500000 y2 28.734224 colour 0 Line x1 49.700001 y1 23.635277 x2 50.299999 y2 23.355330 colour 0 Line x1 49.500000 y1 22.079996 x2 50.500000 y2 22.079996 colour 0 Text3 x1 51.000000 y1 18.299995 colour 0 size 9.600000 t Line x1 50.500000 y1 28.734224 x2 51.500000 y2 28.100136 colour 0 Line x1 50.700001 y1 23.355330 x2 51.299999 y2 23.095020 colour 0 Line x1 50.500000 y1 22.079996 x2 51.500000 y2 22.079996 colour 0 Text3 x1 52.000000 y1 18.299995 colour 0 size 9.600000 g Line x1 51.500000 y1 28.100136 x2 52.500000 y2 27.337486 colour 0 Line x1 51.700001 y1 23.095020 x2 52.299999 y2 22.881302 colour 0 Line x1 51.500000 y1 22.079996 x2 52.500000 y2 22.079996 colour 0 | 
| ##Graphic ##Screen x1 -1.000000 y1 0.000000 x2 60.000000 y2 80.000000 Text3 x1 3.000000 y1 56.099998 colour 0 size 9.600000 t Line x1 2.500000 y1 65.137489 x2 3.500000 y2 65.137489 colour 0 Line x1 2.700000 y1 60.681305 x2 3.300000 y2 60.544445 colour 0 Line x1 2.500000 y1 59.879997 x2 3.500000 y2 59.879997 colour 0 Text3 x1 4.000000 y1 56.099998 colour 0 size 9.600000 c Line x1 3.500000 y1 65.137489 x2 4.500000 y2 64.863533 colour 0 Line x1 3.700000 y1 60.544445 x2 4.300000 y2 60.511105 colour 0 Line x1 3.500000 y1 59.879997 x2 4.500000 y2 59.879997 colour 0 Text3 x1 5.000000 y1 56.099998 colour 0 size 9.600000 c Line x1 4.500000 y1 64.863533 x2 5.500000 y2 63.870514 colour 0 Line x1 4.700000 y1 60.511105 x2 5.300000 y2 60.594872 colour 0 Line x1 4.500000 y1 59.879997 x2 5.500000 y2 59.879997 colour 0 Text3 x1 6.000000 y1 56.099998 colour 0 size 9.600000 a Line x1 5.500000 y1 63.870514 x2 6.500000 y2 65.068802 colour 0 Line x1 5.700000 y1 60.594872 x2 6.300000 y2 60.754246 colour 0 Line x1 5.500000 y1 59.879997 x2 6.500000 y2 59.879997 colour 0 Text3 x1 7.000000 y1 56.099998 colour 0 size 9.600000 a Line x1 6.500000 y1 65.068802 x2 7.500000 y2 66.039978 colour 0 Line x1 6.700000 y1 60.754246 x2 7.300000 y2 60.980507 colour 0 Line x1 6.500000 y1 59.879997 x2 7.500000 y2 59.879997 colour 0 Text3 x1 8.000000 y1 56.099998 colour 0 size 9.600000 c Line x1 7.500000 y1 66.039978 x2 8.500000 y2 66.672760 colour 0 Line x1 7.700000 y1 60.980507 x2 8.300000 y2 61.280891 colour 0 Line x1 7.500000 y1 59.879997 x2 8.500000 y2 59.879997 colour 0 Text3 x1 9.000000 y1 56.099998 colour 0 size 9.600000 g Line x1 8.500000 y1 66.672760 x2 9.500000 y2 67.020500 colour 0 Line x1 8.700000 y1 61.280891 x2 9.300000 y2 61.626850 colour 0 Line x1 8.500000 y1 59.879997 x2 9.500000 y2 59.879997 colour 0 Text3 x1 10.000000 y1 56.099998 colour 0 size 9.600000 t Line x1 9.500000 y1 67.020500 x2 10.500000 y2 67.584343 colour 0 Line x1 9.700000 y1 61.626850 x2 10.300000 y2 61.980312 colour 0 Line x1 9.500000 y1 59.879997 x2 10.500000 y2 59.879997 colour 0 Text3 x1 11.000000 y1 56.099998 colour 0 size 9.600000 g Line x1 10.500000 y1 67.584343 x2 11.500000 y2 66.555504 colour 0 Line x1 10.700000 y1 61.980312 x2 11.300000 y2 62.251072 colour 0 Line x1 10.500000 y1 59.879997 x2 11.500000 y2 59.879997 colour 0 Text3 x1 12.000000 y1 56.099998 colour 0 size 9.600000 c Line x1 11.500000 y1 66.555504 x2 12.500000 y2 65.344254 colour 0 Line x1 11.700000 y1 62.251072 x2 12.300000 y2 62.421207 colour 0 Line x1 11.500000 y1 59.879997 x2 12.500000 y2 59.879997 colour 0 Text3 x1 13.000000 y1 56.099998 colour 0 size 9.600000 t Line x1 12.500000 y1 65.344254 x2 13.500000 y2 68.666405 colour 0 Line x1 12.700000 y1 62.421207 x2 13.300000 y2 62.520817 colour 0 Line x1 12.500000 y1 59.879997 x2 13.500000 y2 59.879997 colour 0 Text3 x1 14.000000 y1 56.099998 colour 0 size 9.600000 g Line x1 13.500000 y1 68.666405 x2 14.500000 y2 69.829361 colour 0 Line x1 13.700000 y1 62.520817 x2 14.300000 y2 62.609585 colour 0 Line x1 13.500000 y1 59.879997 x2 14.500000 y2 59.879997 colour 0 [Part of this file has been deleted for brevity] Line x1 39.500000 y1 28.239981 x2 40.500000 y2 28.872763 colour 0 Line x1 39.700001 y1 25.297359 x2 40.299999 y2 25.211924 colour 0 Line x1 39.500000 y1 22.079996 x2 40.500000 y2 22.079996 colour 0 Text3 x1 41.000000 y1 18.299995 colour 0 size 9.600000 g Line x1 40.500000 y1 28.872763 x2 41.500000 y2 29.220501 colour 0 Line x1 40.700001 y1 25.211924 x2 41.299999 y2 25.157118 colour 0 Line x1 40.500000 y1 22.079996 x2 41.500000 y2 22.079996 colour 0 Text3 x1 42.000000 y1 18.299995 colour 0 size 9.600000 t Line x1 41.500000 y1 29.220501 x2 42.500000 y2 29.784338 colour 0 Line x1 41.700001 y1 25.157118 x2 42.299999 y2 25.166607 colour 0 Line x1 41.500000 y1 22.079996 x2 42.500000 y2 22.079996 colour 0 Text3 x1 43.000000 y1 18.299995 colour 0 size 9.600000 g Line x1 42.500000 y1 29.784338 x2 43.500000 y2 29.301651 colour 0 Line x1 42.700001 y1 25.166607 x2 43.299999 y2 25.246220 colour 0 Line x1 42.500000 y1 22.079996 x2 43.500000 y2 22.079996 colour 0 Text3 x1 44.000000 y1 18.299995 colour 0 size 9.600000 c Line x1 43.500000 y1 29.301651 x2 44.500000 y2 26.716318 colour 0 Line x1 43.700001 y1 25.246220 x2 44.299999 y2 25.346378 colour 0 Line x1 43.500000 y1 22.079996 x2 44.500000 y2 22.079996 colour 0 Text3 x1 45.000000 y1 18.299995 colour 0 size 9.600000 t Line x1 44.500000 y1 26.716318 x2 45.500000 y2 28.517347 colour 0 Line x1 44.700001 y1 25.346378 x2 45.299999 y2 25.396358 colour 0 Line x1 44.500000 y1 22.079996 x2 45.500000 y2 22.079996 colour 0 Text3 x1 46.000000 y1 18.299995 colour 0 size 9.600000 t Line x1 45.500000 y1 28.517347 x2 46.500000 y2 31.040909 colour 0 Line x1 45.700001 y1 25.396358 x2 46.299999 y2 25.410254 colour 0 Line x1 45.500000 y1 22.079996 x2 46.500000 y2 22.079996 colour 0 Text3 x1 47.000000 y1 18.299995 colour 0 size 9.600000 c Line x1 46.500000 y1 31.040909 x2 47.500000 y2 32.029354 colour 0 Line x1 46.700001 y1 25.410254 x2 47.299999 y2 25.458986 colour 0 Line x1 46.500000 y1 22.079996 x2 47.500000 y2 22.079996 colour 0 Text3 x1 48.000000 y1 18.299995 colour 0 size 9.600000 g Line x1 47.500000 y1 32.029354 x2 48.500000 y2 30.866402 colour 0 Line x1 47.700001 y1 25.458986 x2 48.299999 y2 25.576271 colour 0 Line x1 47.500000 y1 22.079996 x2 48.500000 y2 22.079996 colour 0 Text3 x1 49.000000 y1 18.299995 colour 0 size 9.600000 c Line x1 48.500000 y1 30.866402 x2 49.500000 y2 27.544254 colour 0 Line x1 48.700001 y1 25.576271 x2 49.299999 y2 25.788673 colour 0 Line x1 48.500000 y1 22.079996 x2 49.500000 y2 22.079996 colour 0 Text3 x1 50.000000 y1 18.299995 colour 0 size 9.600000 c Line x1 49.500000 y1 27.544254 x2 50.500000 y2 27.402788 colour 0 Line x1 49.700001 y1 25.788673 x2 50.299999 y2 26.104589 colour 0 Line x1 49.500000 y1 22.079996 x2 50.500000 y2 22.079996 colour 0 Text3 x1 51.000000 y1 18.299995 colour 0 size 9.600000 t Line x1 50.500000 y1 27.402788 x2 51.500000 y2 27.126644 colour 0 Line x1 50.700001 y1 26.104589 x2 51.299999 y2 26.532803 colour 0 Line x1 50.500000 y1 22.079996 x2 51.500000 y2 22.079996 colour 0 Text3 x1 52.000000 y1 18.299995 colour 0 size 9.600000 g Line x1 51.500000 y1 27.126644 x2 52.500000 y2 25.793066 colour 0 Line x1 51.700001 y1 26.532803 x2 52.299999 y2 26.954662 colour 0 Line x1 51.500000 y1 22.079996 x2 52.500000 y2 22.079996 colour 0 | 
| ##Graphic ##Screen x1 -1.000000 y1 0.000000 x2 60.000000 y2 80.000000 Text3 x1 3.000000 y1 56.099998 colour 0 size 9.600000 t Line x1 2.500000 y1 63.593067 x2 3.500000 y2 63.099991 colour 0 Line x1 2.700000 y1 64.754662 x2 3.300000 y2 65.133423 colour 0 Line x1 2.500000 y1 59.879997 x2 3.500000 y2 59.879997 colour 0 Text3 x1 4.000000 y1 56.099998 colour 0 size 9.600000 a Line x1 3.500000 y1 63.099991 x2 4.500000 y2 63.593067 colour 0 Line x1 3.700000 y1 65.133423 x2 4.300000 y2 65.494942 colour 0 Line x1 3.500000 y1 59.879997 x2 4.500000 y2 59.879997 colour 0 Text3 x1 5.000000 y1 56.099998 colour 0 size 9.600000 t Line x1 4.500000 y1 63.593067 x2 5.500000 y2 65.282478 colour 0 Line x1 4.700000 y1 65.494942 x2 5.300000 y2 65.884865 colour 0 Line x1 4.500000 y1 59.879997 x2 5.500000 y2 59.879997 colour 0 Text3 x1 6.000000 y1 56.099998 colour 0 size 9.600000 a Line x1 5.500000 y1 65.282478 x2 6.500000 y2 65.556931 colour 0 Line x1 5.700000 y1 65.884865 x2 6.300000 y2 66.289825 colour 0 Line x1 5.500000 y1 59.879997 x2 6.500000 y2 59.879997 colour 0 Text3 x1 7.000000 y1 56.099998 colour 0 size 9.600000 c Line x1 6.500000 y1 65.556931 x2 7.500000 y2 65.699013 colour 0 Line x1 6.700000 y1 66.289825 x2 7.300000 y2 66.623062 colour 0 Line x1 6.500000 y1 59.879997 x2 7.500000 y2 59.879997 colour 0 Text3 x1 8.000000 y1 56.099998 colour 0 size 9.600000 t Line x1 7.500000 y1 65.699013 x2 8.500000 y2 66.739983 colour 0 Line x1 7.700000 y1 66.623062 x2 8.300000 y2 66.775955 colour 0 Line x1 7.500000 y1 59.879997 x2 8.500000 y2 59.879997 colour 0 Text3 x1 9.000000 y1 56.099998 colour 0 size 9.600000 g Line x1 8.500000 y1 66.739983 x2 9.500000 y2 65.699013 colour 0 Line x1 8.700000 y1 66.775955 x2 9.300000 y2 66.715897 colour 0 Line x1 8.500000 y1 59.879997 x2 9.500000 y2 59.879997 colour 0 Text3 x1 10.000000 y1 56.099998 colour 0 size 9.600000 c Line x1 9.500000 y1 65.699013 x2 10.500000 y2 65.344254 colour 0 Line x1 9.700000 y1 66.715897 x2 10.300000 y2 66.529877 colour 0 Line x1 9.500000 y1 59.879997 x2 10.500000 y2 59.879997 colour 0 Text3 x1 11.000000 y1 56.099998 colour 0 size 9.600000 a Line x1 10.500000 y1 65.344254 x2 11.500000 y2 65.137489 colour 0 Line x1 10.700000 y1 66.529877 x2 11.300000 y2 66.281403 colour 0 Line x1 10.500000 y1 59.879997 x2 11.500000 y2 59.879997 colour 0 Text3 x1 12.000000 y1 56.099998 colour 0 size 9.600000 g Line x1 11.500000 y1 65.137489 x2 12.500000 y2 65.137489 colour 0 Line x1 11.700000 y1 66.281403 x2 12.300000 y2 65.988609 colour 0 Line x1 11.500000 y1 59.879997 x2 12.500000 y2 59.879997 colour 0 Text3 x1 13.000000 y1 56.099998 colour 0 size 9.600000 g Line x1 12.500000 y1 65.137489 x2 13.500000 y2 66.039978 colour 0 Line x1 12.700000 y1 65.988609 x2 13.300000 y2 65.580658 colour 0 Line x1 12.500000 y1 59.879997 x2 13.500000 y2 59.879997 colour 0 Text3 x1 14.000000 y1 56.099998 colour 0 size 9.600000 a Line x1 13.500000 y1 66.039978 x2 14.500000 y2 66.039986 colour 0 Line x1 13.700000 y1 65.580658 x2 14.300000 y2 65.121658 colour 0 Line x1 13.500000 y1 59.879997 x2 14.500000 y2 59.879997 colour 0 [Part of this file has been deleted for brevity] Line x1 39.500000 y1 27.337502 x2 40.500000 y2 28.872778 colour 0 Line x1 39.700001 y1 23.195297 x2 40.299999 y2 23.514282 colour 0 Line x1 39.500000 y1 22.079996 x2 40.500000 y2 22.079996 colour 0 Text3 x1 41.000000 y1 18.299995 colour 0 size 9.600000 c Line x1 40.500000 y1 28.872778 x2 41.500000 y2 28.872780 colour 0 Line x1 40.700001 y1 23.514282 x2 41.299999 y2 23.725180 colour 0 Line x1 40.500000 y1 22.079996 x2 41.500000 y2 22.079996 colour 0 Text3 x1 42.000000 y1 18.299995 colour 0 size 9.600000 a Line x1 41.500000 y1 28.872780 x2 42.500000 y2 29.439163 colour 0 Line x1 41.700001 y1 23.725180 x2 42.299999 y2 23.913563 colour 0 Line x1 41.500000 y1 22.079996 x2 42.500000 y2 22.079996 colour 0 Text3 x1 43.000000 y1 18.299995 colour 0 size 9.600000 c Line x1 42.500000 y1 29.439163 x2 43.500000 y2 30.619995 colour 0 Line x1 42.700001 y1 23.913563 x2 43.299999 y2 24.094639 colour 0 Line x1 42.500000 y1 22.079996 x2 43.500000 y2 22.079996 colour 0 Text3 x1 44.000000 y1 18.299995 colour 0 size 9.600000 g Line x1 43.500000 y1 30.619995 x2 44.500000 y2 29.027782 colour 0 Line x1 43.700001 y1 24.094639 x2 44.299999 y2 24.189131 colour 0 Line x1 43.500000 y1 22.079996 x2 44.500000 y2 22.079996 colour 0 Text3 x1 45.000000 y1 18.299995 colour 0 size 9.600000 c Line x1 44.500000 y1 29.027782 x2 45.500000 y2 30.461620 colour 0 Line x1 44.700001 y1 24.189131 x2 45.299999 y2 24.257393 colour 0 Line x1 44.500000 y1 22.079996 x2 45.500000 y2 22.079996 colour 0 Text3 x1 46.000000 y1 18.299995 colour 0 size 9.600000 g Line x1 45.500000 y1 30.461620 x2 46.500000 y2 32.029377 colour 0 Line x1 45.700001 y1 24.257393 x2 46.299999 y2 24.323923 colour 0 Line x1 45.500000 y1 22.079996 x2 46.500000 y2 22.079996 colour 0 Text3 x1 47.000000 y1 18.299995 colour 0 size 9.600000 g Line x1 46.500000 y1 32.029377 x2 47.500000 y2 30.619995 colour 0 Line x1 46.700001 y1 24.323923 x2 47.299999 y2 24.341715 colour 0 Line x1 46.500000 y1 22.079996 x2 47.500000 y2 22.079996 colour 0 Text3 x1 48.000000 y1 18.299995 colour 0 size 9.600000 c Line x1 47.500000 y1 30.619995 x2 48.500000 y2 30.619995 colour 0 Line x1 47.700001 y1 24.341715 x2 48.299999 y2 24.317759 colour 0 Line x1 47.500000 y1 22.079996 x2 48.500000 y2 22.079996 colour 0 Text3 x1 49.000000 y1 18.299995 colour 0 size 9.600000 g Line x1 48.500000 y1 30.619995 x2 49.500000 y2 30.619993 colour 0 Line x1 48.700001 y1 24.317759 x2 49.299999 y2 24.263830 colour 0 Line x1 48.500000 y1 22.079996 x2 49.500000 y2 22.079996 colour 0 Text3 x1 50.000000 y1 18.299995 colour 0 size 9.600000 c Line x1 49.500000 y1 30.619993 x2 50.500000 y2 30.619995 colour 0 Line x1 49.700001 y1 24.263830 x2 50.299999 y2 24.170185 colour 0 Line x1 49.500000 y1 22.079996 x2 50.500000 y2 22.079996 colour 0 Text3 x1 51.000000 y1 18.299995 colour 0 size 9.600000 g Line x1 50.500000 y1 30.619995 x2 51.500000 y2 29.439163 colour 0 Line x1 50.700001 y1 24.170185 x2 51.299999 y2 24.108047 colour 0 Line x1 50.500000 y1 22.079996 x2 51.500000 y2 22.079996 colour 0 Text3 x1 52.000000 y1 18.299995 colour 0 size 9.600000 c Line x1 51.500000 y1 29.439163 x2 52.500000 y2 28.872780 colour 0 Line x1 51.700001 y1 24.108047 x2 52.299999 y2 24.028463 colour 0 Line x1 51.500000 y1 22.079996 x2 52.500000 y2 22.079996 colour 0 | 
| ##Graphic ##Screen x1 -1.000000 y1 0.000000 x2 60.000000 y2 80.000000 Text3 x1 3.000000 y1 56.099998 colour 0 size 9.600000 g Line x1 2.500000 y1 66.672783 x2 3.500000 y2 66.534241 colour 0 Line x1 2.700000 y1 61.828465 x2 3.300000 y2 61.655922 colour 0 Line x1 2.500000 y1 59.879997 x2 3.500000 y2 59.879997 colour 0 Text3 x1 4.000000 y1 56.099998 colour 0 size 9.600000 t Line x1 3.500000 y1 66.534241 x2 4.500000 y2 65.900146 colour 0 Line x1 3.700000 y1 61.655922 x2 4.300000 y2 61.406979 colour 0 Line x1 3.500000 y1 59.879997 x2 4.500000 y2 59.879997 colour 0 Text3 x1 5.000000 y1 56.099998 colour 0 size 9.600000 g Line x1 4.500000 y1 65.900146 x2 5.500000 y2 65.137497 colour 0 Line x1 4.700000 y1 61.406979 x2 5.300000 y2 61.120132 colour 0 Line x1 4.500000 y1 59.879997 x2 5.500000 y2 59.879997 colour 0 Text3 x1 6.000000 y1 56.099998 colour 0 size 9.600000 t Line x1 5.500000 y1 65.137497 x2 6.500000 y2 64.712364 colour 0 Line x1 5.700000 y1 61.120132 x2 6.300000 y2 60.966145 colour 0 Line x1 5.500000 y1 59.879997 x2 6.500000 y2 59.879997 colour 0 Text3 x1 7.000000 y1 56.099998 colour 0 size 9.600000 c Line x1 6.500000 y1 64.712364 x2 7.500000 y2 65.621460 colour 0 Line x1 6.700000 y1 60.966145 x2 7.300000 y2 61.082634 colour 0 Line x1 6.500000 y1 59.879997 x2 7.500000 y2 59.879997 colour 0 Text3 x1 8.000000 y1 56.099998 colour 0 size 9.600000 c Line x1 7.500000 y1 65.621460 x2 8.500000 y2 65.068817 colour 0 Line x1 7.700000 y1 61.082634 x2 8.300000 y2 61.373489 colour 0 Line x1 7.500000 y1 59.879997 x2 8.500000 y2 59.879997 colour 0 Text3 x1 9.000000 y1 56.099998 colour 0 size 9.600000 g Line x1 8.500000 y1 65.068817 x2 9.500000 y2 63.249977 colour 0 Line x1 8.700000 y1 61.373489 x2 9.300000 y2 61.680435 colour 0 Line x1 8.500000 y1 59.879997 x2 9.500000 y2 59.879997 colour 0 Text3 x1 10.000000 y1 56.099998 colour 0 size 9.600000 t Line x1 9.500000 y1 63.249977 x2 10.500000 y2 65.487457 colour 0 Line x1 9.700000 y1 61.680435 x2 10.300000 y2 61.938332 colour 0 Line x1 9.500000 y1 59.879997 x2 10.500000 y2 59.879997 colour 0 Text3 x1 11.000000 y1 56.099998 colour 0 size 9.600000 a Line x1 10.500000 y1 65.487457 x2 11.500000 y2 69.829376 colour 0 Line x1 10.700000 y1 61.938332 x2 11.300000 y2 62.114067 colour 0 Line x1 10.500000 y1 59.879997 x2 11.500000 y2 59.879997 colour 0 Text3 x1 12.000000 y1 56.099998 colour 0 size 9.600000 g Line x1 11.500000 y1 69.829376 x2 12.500000 y2 69.006210 colour 0 Line x1 11.700000 y1 62.114067 x2 12.300000 y2 62.217670 colour 0 Line x1 11.500000 y1 59.879997 x2 12.500000 y2 59.879997 colour 0 Text3 x1 13.000000 y1 56.099998 colour 0 size 9.600000 c Line x1 12.500000 y1 69.006210 x2 13.500000 y2 65.974632 colour 0 Line x1 12.700000 y1 62.217670 x2 13.300000 y2 62.395550 colour 0 Line x1 12.500000 y1 59.879997 x2 13.500000 y2 59.879997 colour 0 Text3 x1 14.000000 y1 56.099998 colour 0 size 9.600000 c Line x1 13.500000 y1 65.974632 x2 14.500000 y2 66.827782 colour 0 Line x1 13.700000 y1 62.395550 x2 14.300000 y2 62.722477 colour 0 Line x1 13.500000 y1 59.879997 x2 14.500000 y2 59.879997 colour 0 [Part of this file has been deleted for brevity] Line x1 39.500000 y1 27.337498 x2 40.500000 y2 27.337502 colour 0 Line x1 39.700001 y1 23.704887 x2 40.299999 y2 23.752375 colour 0 Line x1 39.500000 y1 22.079996 x2 40.500000 y2 22.079996 colour 0 Text3 x1 41.000000 y1 18.299995 colour 0 size 9.600000 c Line x1 40.500000 y1 27.337502 x2 41.500000 y2 27.544268 colour 0 Line x1 40.700001 y1 23.752375 x2 41.299999 y2 23.564182 colour 0 Line x1 40.500000 y1 22.079996 x2 41.500000 y2 22.079996 colour 0 Text3 x1 42.000000 y1 18.299995 colour 0 size 9.600000 c Line x1 41.500000 y1 27.544268 x2 42.500000 y2 27.544266 colour 0 Line x1 41.700001 y1 23.564182 x2 42.299999 y2 23.118820 colour 0 Line x1 41.500000 y1 22.079996 x2 42.500000 y2 22.079996 colour 0 Text3 x1 43.000000 y1 18.299995 colour 0 size 9.600000 t Line x1 42.500000 y1 27.544266 x2 43.500000 y2 27.337500 colour 0 Line x1 42.700001 y1 23.118820 x2 43.299999 y2 22.534410 colour 0 Line x1 42.500000 y1 22.079996 x2 43.500000 y2 22.079996 colour 0 Text3 x1 44.000000 y1 18.299995 colour 0 size 9.600000 g Line x1 43.500000 y1 27.337500 x2 44.500000 y2 27.337498 colour 0 Line x1 43.700001 y1 22.534410 x2 44.299999 y2 22.310282 colour 0 Line x1 43.500000 y1 22.079996 x2 44.500000 y2 22.079996 colour 0 Text3 x1 45.000000 y1 18.299995 colour 0 size 9.600000 g Line x1 44.500000 y1 27.337498 x2 45.500000 y2 28.239996 colour 0 Line x1 44.700001 y1 22.310282 x2 45.299999 y2 22.911077 colour 0 Line x1 44.500000 y1 22.079996 x2 45.500000 y2 22.079996 colour 0 Text3 x1 46.000000 y1 18.299995 colour 0 size 9.600000 a Line x1 45.500000 y1 28.239996 x2 46.500000 y2 28.239996 colour 0 Line x1 45.700001 y1 22.911077 x2 46.299999 y2 23.363279 colour 0 Line x1 45.500000 y1 22.079996 x2 46.500000 y2 22.079996 colour 0 Text3 x1 47.000000 y1 18.299995 colour 0 size 9.600000 g Line x1 46.500000 y1 28.239996 x2 47.500000 y2 27.268816 colour 0 Line x1 46.700001 y1 23.363279 x2 47.299999 y2 23.501680 colour 0 Line x1 46.500000 y1 22.079996 x2 47.500000 y2 22.079996 colour 0 Text3 x1 48.000000 y1 18.299995 colour 0 size 9.600000 g Line x1 47.500000 y1 27.268816 x2 48.500000 y2 26.070522 colour 0 Line x1 47.700001 y1 23.501680 x2 48.299999 y2 23.429630 colour 0 Line x1 47.500000 y1 22.079996 x2 48.500000 y2 22.079996 colour 0 Text3 x1 49.000000 y1 18.299995 colour 0 size 9.600000 t Line x1 48.500000 y1 26.070522 x2 49.500000 y2 27.063545 colour 0 Line x1 48.700001 y1 23.429630 x2 49.299999 y2 23.272100 colour 0 Line x1 48.500000 y1 22.079996 x2 49.500000 y2 22.079996 colour 0 Text3 x1 50.000000 y1 18.299995 colour 0 size 9.600000 t Line x1 49.500000 y1 27.063545 x2 50.500000 y2 30.866421 colour 0 Line x1 49.700001 y1 23.272100 x2 50.299999 y2 23.060772 colour 0 Line x1 49.500000 y1 22.079996 x2 50.500000 y2 22.079996 colour 0 Text3 x1 51.000000 y1 18.299995 colour 0 size 9.600000 g Line x1 50.500000 y1 30.866421 x2 51.500000 y2 32.029373 colour 0 Line x1 50.700001 y1 23.060772 x2 51.299999 y2 22.790617 colour 0 Line x1 50.500000 y1 22.079996 x2 51.500000 y2 22.079996 colour 0 Text3 x1 52.000000 y1 18.299995 colour 0 size 9.600000 g Line x1 51.500000 y1 32.029373 x2 52.500000 y2 30.619993 colour 0 Line x1 51.700001 y1 22.790617 x2 52.299999 y2 22.560194 colour 0 Line x1 51.500000 y1 22.079996 x2 52.500000 y2 22.079996 colour 0 | 
| ##Graphic ##Screen x1 -1.000000 y1 0.000000 x2 60.000000 y2 80.000000 Text3 x1 3.000000 y1 56.099998 colour 0 size 9.600000 c Line x1 2.500000 y1 68.419998 x2 3.500000 y2 69.829384 colour 0 Line x1 2.700000 y1 60.360195 x2 3.300000 y2 60.585083 colour 0 Line x1 2.500000 y1 59.879997 x2 3.500000 y2 59.879997 colour 0 Text3 x1 4.000000 y1 56.099998 colour 0 size 9.600000 g Line x1 3.500000 y1 69.829384 x2 4.500000 y2 68.666420 colour 0 Line x1 3.700000 y1 60.585083 x2 4.300000 y2 61.013474 colour 0 Line x1 3.500000 y1 59.879997 x2 4.500000 y2 59.879997 colour 0 Text3 x1 5.000000 y1 56.099998 colour 0 size 9.600000 c Line x1 4.500000 y1 68.666420 x2 5.500000 y2 65.344269 colour 0 Line x1 4.700000 y1 61.013474 x2 5.300000 y2 61.481312 colour 0 Line x1 4.500000 y1 59.879997 x2 5.500000 y2 59.879997 colour 0 Text3 x1 6.000000 y1 56.099998 colour 0 size 9.600000 c Line x1 5.500000 y1 65.344269 x2 6.500000 y2 65.344269 colour 0 Line x1 5.700000 y1 61.481312 x2 6.300000 y2 61.902317 colour 0 Line x1 5.500000 y1 59.879997 x2 6.500000 y2 59.879997 colour 0 Text3 x1 7.000000 y1 56.099998 colour 0 size 9.600000 a Line x1 6.500000 y1 65.344269 x2 7.500000 y2 68.666420 colour 0 Line x1 6.700000 y1 61.902317 x2 7.300000 y2 62.285797 colour 0 Line x1 6.500000 y1 59.879997 x2 7.500000 y2 59.879997 colour 0 Text3 x1 8.000000 y1 56.099998 colour 0 size 9.600000 g Line x1 7.500000 y1 68.666420 x2 8.500000 y2 69.829376 colour 0 Line x1 7.700000 y1 62.285797 x2 8.300000 y2 62.709629 colour 0 Line x1 7.500000 y1 59.879997 x2 8.500000 y2 59.879997 colour 0 Text3 x1 9.000000 y1 56.099998 colour 0 size 9.600000 g Line x1 8.500000 y1 69.829376 x2 9.500000 y2 67.239166 colour 0 Line x1 8.700000 y1 62.709629 x2 9.300000 y2 63.136963 colour 0 Line x1 8.500000 y1 59.879997 x2 9.500000 y2 59.879997 colour 0 Text3 x1 10.000000 y1 56.099998 colour 0 size 9.600000 c Line x1 9.500000 y1 67.239166 x2 10.500000 y2 65.068817 colour 0 Line x1 9.700000 y1 63.136963 x2 10.300000 y2 63.549591 colour 0 Line x1 9.500000 y1 59.879997 x2 10.500000 y2 59.879997 colour 0 Text3 x1 11.000000 y1 56.099998 colour 0 size 9.600000 g Line x1 10.500000 y1 65.068817 x2 11.500000 y2 63.870525 colour 0 Line x1 10.700000 y1 63.549591 x2 11.300000 y2 63.774986 colour 0 Line x1 10.500000 y1 59.879997 x2 11.500000 y2 59.879997 colour 0 Text3 x1 12.000000 y1 56.099998 colour 0 size 9.600000 t Line x1 11.500000 y1 63.870525 x2 12.500000 y2 65.221176 colour 0 Line x1 11.700000 y1 63.774986 x2 12.300000 y2 63.695034 colour 0 Line x1 11.500000 y1 59.879997 x2 12.500000 y2 59.879997 colour 0 Text3 x1 13.000000 y1 56.099998 colour 0 size 9.600000 t Line x1 12.500000 y1 65.221176 x2 13.500000 y2 67.584358 colour 0 Line x1 12.700000 y1 63.695034 x2 13.300000 y2 63.577522 colour 0 Line x1 12.500000 y1 59.879997 x2 13.500000 y2 59.879997 colour 0 Text3 x1 14.000000 y1 56.099998 colour 0 size 9.600000 g Line x1 13.500000 y1 67.584358 x2 14.500000 y2 67.101669 colour 0 Line x1 13.700000 y1 63.577522 x2 14.300000 y2 63.684277 colour 0 Line x1 13.500000 y1 59.879997 x2 14.500000 y2 59.879997 colour 0 [Part of this file has been deleted for brevity] Line x1 39.500000 y1 25.650585 x2 40.500000 y2 25.862219 colour 0 Line x1 39.700001 y1 26.883873 x2 40.299999 y2 26.705715 colour 0 Line x1 39.500000 y1 22.079996 x2 40.500000 y2 22.079996 colour 0 Text3 x1 41.000000 y1 18.299995 colour 0 size 9.600000 a Line x1 40.500000 y1 25.862219 x2 41.500000 y2 27.268816 colour 0 Line x1 40.700001 y1 26.705715 x2 41.299999 y2 26.361605 colour 0 Line x1 40.500000 y1 22.079996 x2 41.500000 y2 22.079996 colour 0 Text3 x1 42.000000 y1 18.299995 colour 0 size 9.600000 a Line x1 41.500000 y1 27.268816 x2 42.500000 y2 29.439163 colour 0 Line x1 41.700001 y1 26.361605 x2 42.299999 y2 25.989441 colour 0 Line x1 41.500000 y1 22.079996 x2 42.500000 y2 22.079996 colour 0 Text3 x1 43.000000 y1 18.299995 colour 0 size 9.600000 c Line x1 42.500000 y1 29.439163 x2 43.500000 y2 29.784357 colour 0 Line x1 42.700001 y1 25.989441 x2 43.299999 y2 25.613720 colour 0 Line x1 42.500000 y1 22.079996 x2 43.500000 y2 22.079996 colour 0 Text3 x1 44.000000 y1 18.299995 colour 0 size 9.600000 g Line x1 43.500000 y1 29.784357 x2 44.500000 y2 27.899023 colour 0 Line x1 43.700001 y1 25.613720 x2 44.299999 y2 25.178097 colour 0 Line x1 43.500000 y1 22.079996 x2 44.500000 y2 22.079996 colour 0 Text3 x1 45.000000 y1 18.299995 colour 0 size 9.600000 c Line x1 44.500000 y1 27.899023 x2 45.500000 y2 27.544266 colour 0 Line x1 44.700001 y1 25.178097 x2 45.299999 y2 24.749300 colour 0 Line x1 44.500000 y1 22.079996 x2 45.500000 y2 22.079996 colour 0 Text3 x1 46.000000 y1 18.299995 colour 0 size 9.600000 a Line x1 45.500000 y1 27.544266 x2 46.500000 y2 28.239996 colour 0 Line x1 45.700001 y1 24.749300 x2 46.299999 y2 24.392624 colour 0 Line x1 45.500000 y1 22.079996 x2 46.500000 y2 22.079996 colour 0 Text3 x1 47.000000 y1 18.299995 colour 0 size 9.600000 g Line x1 46.500000 y1 28.239996 x2 47.500000 y2 28.239998 colour 0 Line x1 46.700001 y1 24.392624 x2 47.299999 y2 24.093620 colour 0 Line x1 46.500000 y1 22.079996 x2 47.500000 y2 22.079996 colour 0 Text3 x1 48.000000 y1 18.299995 colour 0 size 9.600000 g Line x1 47.500000 y1 28.239998 x2 48.500000 y2 27.337500 colour 0 Line x1 47.700001 y1 24.093620 x2 48.299999 y2 23.838955 colour 0 Line x1 47.500000 y1 22.079996 x2 48.500000 y2 22.079996 colour 0 Text3 x1 49.000000 y1 18.299995 colour 0 size 9.600000 t Line x1 48.500000 y1 27.337500 x2 49.500000 y2 27.693478 colour 0 Line x1 48.700001 y1 23.838955 x2 49.299999 y2 23.746645 colour 0 Line x1 48.500000 y1 22.079996 x2 49.500000 y2 22.079996 colour 0 Text3 x1 50.000000 y1 18.299995 colour 0 size 9.600000 c Line x1 49.500000 y1 27.693478 x2 50.500000 y2 28.174627 colour 0 Line x1 49.700001 y1 23.746645 x2 50.299999 y2 23.926151 colour 0 Line x1 49.500000 y1 22.079996 x2 50.500000 y2 22.079996 colour 0 Text3 x1 51.000000 y1 18.299995 colour 0 size 9.600000 c Line x1 50.500000 y1 28.174627 x2 51.500000 y2 29.456642 colour 0 Line x1 50.700001 y1 23.926151 x2 51.299999 y2 24.253151 colour 0 Line x1 50.500000 y1 22.079996 x2 51.500000 y2 22.079996 colour 0 Text3 x1 52.000000 y1 18.299995 colour 0 size 9.600000 c Line x1 51.500000 y1 29.456642 x2 52.500000 y2 29.797428 colour 0 Line x1 51.700001 y1 24.253151 x2 52.299999 y2 24.528040 colour 0 Line x1 51.500000 y1 22.079996 x2 52.500000 y2 22.079996 colour 0 | 
| ##Graphic ##Screen x1 -1.000000 y1 0.000000 x2 60.000000 y2 80.000000 Text3 x1 3.000000 y1 56.099998 colour 0 size 9.600000 g Line x1 2.500000 y1 67.597427 x2 3.500000 y2 66.674149 colour 0 Line x1 2.700000 y1 62.328041 x2 3.300000 y2 62.416805 colour 0 Line x1 2.500000 y1 59.879997 x2 3.500000 y2 59.879997 colour 0 Text3 x1 4.000000 y1 56.099998 colour 0 size 9.600000 a Line x1 3.500000 y1 66.674149 x2 4.500000 y2 66.743393 colour 0 Line x1 3.700000 y1 62.416805 x2 4.300000 y2 62.254288 colour 0 Line x1 3.500000 y1 59.879997 x2 4.500000 y2 59.879997 colour 0 Text3 x1 5.000000 y1 56.099998 colour 0 size 9.600000 t Line x1 4.500000 y1 66.743393 x2 5.500000 y2 65.970032 colour 0 Line x1 4.700000 y1 62.254288 x2 5.300000 y2 61.970638 colour 0 Line x1 4.500000 y1 59.879997 x2 5.500000 y2 59.879997 colour 0 Text3 x1 6.000000 y1 56.099998 colour 0 size 9.600000 g Line x1 5.500000 y1 65.970032 x2 6.500000 y2 65.899994 colour 0 Line x1 5.700000 y1 61.970638 x2 6.300000 y2 61.661148 colour 0 Line x1 5.500000 y1 59.879997 x2 6.500000 y2 59.879997 colour 0 Text3 x1 7.000000 y1 56.099998 colour 0 size 9.600000 a Line x1 6.500000 y1 65.899994 x2 7.500000 y2 67.597427 colour 0 Line x1 6.700000 y1 61.661148 x2 7.300000 y2 61.432491 colour 0 Line x1 6.500000 y1 59.879997 x2 7.500000 y2 59.879997 colour 0 Text3 x1 8.000000 y1 56.099998 colour 0 size 9.600000 t Line x1 7.500000 y1 67.597427 x2 8.500000 y2 68.840935 colour 0 Line x1 7.700000 y1 61.432491 x2 8.300000 y2 61.330074 colour 0 Line x1 7.500000 y1 59.879997 x2 8.500000 y2 59.879997 colour 0 Text3 x1 9.000000 y1 56.099998 colour 0 size 9.600000 c Line x1 8.500000 y1 68.840935 x2 9.500000 y2 69.829376 colour 0 Line x1 8.700000 y1 61.330074 x2 9.300000 y2 61.328548 colour 0 Line x1 8.500000 y1 59.879997 x2 9.500000 y2 59.879997 colour 0 Text3 x1 10.000000 y1 56.099998 colour 0 size 9.600000 g Line x1 9.500000 y1 69.829376 x2 10.500000 y2 68.261620 colour 0 Line x1 9.700000 y1 61.328548 x2 10.300000 y2 61.365147 colour 0 Line x1 9.500000 y1 59.879997 x2 10.500000 y2 59.879997 colour 0 Text3 x1 11.000000 y1 56.099998 colour 0 size 9.600000 c Line x1 10.500000 y1 68.261620 x2 11.500000 y2 65.199997 colour 0 Line x1 10.700000 y1 61.365147 x2 11.300000 y2 61.341957 colour 0 Line x1 10.500000 y1 59.879997 x2 11.500000 y2 59.879997 colour 0 Text3 x1 12.000000 y1 56.099998 colour 0 size 9.600000 c Line x1 11.500000 y1 65.199997 x2 12.500000 y2 68.261627 colour 0 Line x1 11.700000 y1 61.341957 x2 12.300000 y2 61.208698 colour 0 Line x1 11.500000 y1 59.879997 x2 12.500000 y2 59.879997 colour 0 Text3 x1 13.000000 y1 56.099998 colour 0 size 9.600000 g Line x1 12.500000 y1 68.261627 x2 13.500000 y2 69.829376 colour 0 Line x1 12.700000 y1 61.208698 x2 13.300000 y2 61.004723 colour 0 Line x1 12.500000 y1 59.879997 x2 13.500000 y2 59.879997 colour 0 Text3 x1 14.000000 y1 56.099998 colour 0 size 9.600000 g Line x1 13.500000 y1 69.829376 x2 14.500000 y2 68.419998 colour 0 Line x1 13.700000 y1 61.004723 x2 14.300000 y2 60.776646 colour 0 Line x1 13.500000 y1 59.879997 x2 14.500000 y2 59.879997 colour 0 [Part of this file has been deleted for brevity] Line x1 39.500000 y1 27.337502 x2 40.500000 y2 25.932964 colour 0 Line x1 39.700001 y1 26.760599 x2 40.299999 y2 26.561569 colour 0 Line x1 39.500000 y1 22.079996 x2 40.500000 y2 22.079996 colour 0 Text3 x1 41.000000 y1 18.299995 colour 0 size 9.600000 g Line x1 40.500000 y1 25.932964 x2 41.500000 y2 23.838167 colour 0 Line x1 40.700001 y1 26.561569 x2 41.299999 y2 26.351309 colour 0 Line x1 40.500000 y1 22.079996 x2 41.500000 y2 22.079996 colour 0 Text3 x1 42.000000 y1 18.299995 colour 0 size 9.600000 a Line x1 41.500000 y1 23.838167 x2 42.500000 y2 22.519539 colour 0 Line x1 41.700001 y1 26.351309 x2 42.299999 y2 26.186653 colour 0 Line x1 41.500000 y1 22.079996 x2 42.500000 y2 22.079996 colour 0 Text3 x1 43.000000 y1 18.299995 colour 0 size 9.600000 a Line x1 42.500000 y1 22.519539 x2 43.500000 y2 26.406086 colour 0 Line x1 42.700001 y1 26.186653 x2 43.299999 y2 26.055756 colour 0 Line x1 42.500000 y1 22.079996 x2 43.500000 y2 22.079996 colour 0 Text3 x1 44.000000 y1 18.299995 colour 0 size 9.600000 a Line x1 43.500000 y1 26.406086 x2 44.500000 y2 28.943394 colour 0 Line x1 43.700001 y1 26.055756 x2 44.299999 y2 25.993536 colour 0 Line x1 43.500000 y1 22.079996 x2 44.500000 y2 22.079996 colour 0 Text3 x1 45.000000 y1 18.299995 colour 0 size 9.600000 t Line x1 44.500000 y1 28.943394 x2 45.500000 y2 28.239994 colour 0 Line x1 44.700001 y1 25.993536 x2 45.299999 y2 25.990919 colour 0 Line x1 44.500000 y1 22.079996 x2 45.500000 y2 22.079996 colour 0 Text3 x1 46.000000 y1 18.299995 colour 0 size 9.600000 g Line x1 45.500000 y1 28.239994 x2 46.500000 y2 28.872778 colour 0 Line x1 45.700001 y1 25.990919 x2 46.299999 y2 26.011547 colour 0 Line x1 45.500000 y1 22.079996 x2 46.500000 y2 22.079996 colour 0 Text3 x1 47.000000 y1 18.299995 colour 0 size 9.600000 g Line x1 46.500000 y1 28.872778 x2 47.500000 y2 28.872778 colour 0 Line x1 46.700001 y1 26.011547 x2 47.299999 y2 25.996109 colour 0 Line x1 46.500000 y1 22.079996 x2 47.500000 y2 22.079996 colour 0 Text3 x1 48.000000 y1 18.299995 colour 0 size 9.600000 t Line x1 47.500000 y1 28.872778 x2 48.500000 y2 28.590891 colour 0 Line x1 47.700001 y1 25.996109 x2 48.299999 y2 25.948637 colour 0 Line x1 47.500000 y1 22.079996 x2 48.500000 y2 22.079996 colour 0 Text3 x1 49.000000 y1 18.299995 colour 0 size 9.600000 g Line x1 48.500000 y1 28.590891 x2 49.500000 y2 31.206211 colour 0 Line x1 48.700001 y1 25.948637 x2 49.299999 y2 25.882650 colour 0 Line x1 48.500000 y1 22.079996 x2 49.500000 y2 22.079996 colour 0 Text3 x1 50.000000 y1 18.299995 colour 0 size 9.600000 g Line x1 49.500000 y1 31.206211 x2 50.500000 y2 33.419994 colour 0 Line x1 49.700001 y1 25.882650 x2 50.299999 y2 25.782412 colour 0 Line x1 49.500000 y1 22.079996 x2 50.500000 y2 22.079996 colour 0 Text3 x1 51.000000 y1 18.299995 colour 0 size 9.600000 g Line x1 50.500000 y1 33.419994 x2 51.500000 y2 30.866421 colour 0 Line x1 50.700001 y1 25.782412 x2 51.299999 y2 25.683743 colour 0 Line x1 50.500000 y1 22.079996 x2 51.500000 y2 22.079996 colour 0 Text3 x1 52.000000 y1 18.299995 colour 0 size 9.600000 c Line x1 51.500000 y1 30.866421 x2 52.500000 y2 27.544268 colour 0 Line x1 51.700001 y1 25.683743 x2 52.299999 y2 25.548004 colour 0 Line x1 51.500000 y1 22.079996 x2 52.500000 y2 22.079996 colour 0 | 
| ##Graphic ##Screen x1 -1.000000 y1 0.000000 x2 60.000000 y2 80.000000 Text3 x1 3.000000 y1 56.099998 colour 0 size 9.600000 c Line x1 2.500000 y1 65.344269 x2 3.500000 y2 66.555527 colour 0 Line x1 2.700000 y1 63.348003 x2 3.300000 y2 63.123909 colour 0 Line x1 2.500000 y1 59.879997 x2 3.500000 y2 59.879997 colour 0 Text3 x1 4.000000 y1 56.099998 colour 0 size 9.600000 a Line x1 3.500000 y1 66.555527 x2 4.500000 y2 68.419998 colour 0 Line x1 3.700000 y1 63.123909 x2 4.300000 y2 62.875870 colour 0 Line x1 3.500000 y1 59.879997 x2 4.500000 y2 59.879997 colour 0 Text3 x1 5.000000 y1 56.099998 colour 0 size 9.600000 g Line x1 4.500000 y1 68.419998 x2 5.500000 y2 67.239166 colour 0 Line x1 4.700000 y1 62.875870 x2 5.300000 y2 62.678192 colour 0 Line x1 4.500000 y1 59.879997 x2 5.500000 y2 59.879997 colour 0 Text3 x1 6.000000 y1 56.099998 colour 0 size 9.600000 c Line x1 5.500000 y1 67.239166 x2 6.500000 y2 67.665863 colour 0 Line x1 5.700000 y1 62.678192 x2 6.300000 y2 62.539165 colour 0 Line x1 5.500000 y1 59.879997 x2 6.500000 y2 59.879997 colour 0 Text3 x1 7.000000 y1 56.099998 colour 0 size 9.600000 t Line x1 6.500000 y1 67.665863 x2 7.500000 y2 67.665863 colour 0 Line x1 6.700000 y1 62.539165 x2 7.300000 y2 62.422817 colour 0 Line x1 6.500000 y1 59.879997 x2 7.500000 y2 59.879997 colour 0 Text3 x1 8.000000 y1 56.099998 colour 0 size 9.600000 c Line x1 7.500000 y1 67.665863 x2 8.500000 y2 66.672775 colour 0 Line x1 7.700000 y1 62.422817 x2 8.300000 y2 62.339989 colour 0 Line x1 7.500000 y1 59.879997 x2 8.500000 y2 59.879997 colour 0 Text3 x1 9.000000 y1 56.099998 colour 0 size 9.600000 g Line x1 8.500000 y1 66.672775 x2 9.500000 y2 66.672775 colour 0 Line x1 8.700000 y1 62.339989 x2 9.300000 y2 62.321426 colour 0 Line x1 8.500000 y1 59.879997 x2 9.500000 y2 59.879997 colour 0 Text3 x1 10.000000 y1 56.099998 colour 0 size 9.600000 t Line x1 9.500000 y1 66.672775 x2 10.500000 y2 66.390892 colour 0 Line x1 9.700000 y1 62.321426 x2 10.300000 y2 62.246059 colour 0 Line x1 9.500000 y1 59.879997 x2 10.500000 y2 59.879997 colour 0 Text3 x1 11.000000 y1 56.099998 colour 0 size 9.600000 g Line x1 10.500000 y1 66.390892 x2 11.500000 y2 69.006210 colour 0 Line x1 10.700000 y1 62.246059 x2 11.300000 y2 61.992630 colour 0 Line x1 10.500000 y1 59.879997 x2 11.500000 y2 59.879997 colour 0 Text3 x1 12.000000 y1 56.099998 colour 0 size 9.600000 g Line x1 11.500000 y1 69.006210 x2 12.500000 y2 69.006210 colour 0 Line x1 11.700000 y1 61.992630 x2 12.300000 y2 61.625458 colour 0 Line x1 11.500000 y1 59.879997 x2 12.500000 y2 59.879997 colour 0 Text3 x1 13.000000 y1 56.099998 colour 0 size 9.600000 g Line x1 12.500000 y1 69.006210 x2 13.500000 y2 67.090805 colour 0 Line x1 12.700000 y1 61.625458 x2 13.300000 y2 61.247803 colour 0 Line x1 12.500000 y1 59.879997 x2 13.500000 y2 59.879997 colour 0 Text3 x1 14.000000 y1 56.099998 colour 0 size 9.600000 c Line x1 13.500000 y1 67.090805 x2 14.500000 y2 66.674149 colour 0 Line x1 13.700000 y1 61.247803 x2 14.300000 y2 60.848763 colour 0 Line x1 13.500000 y1 59.879997 x2 14.500000 y2 59.879997 colour 0 [Part of this file has been deleted for brevity] Line x1 39.500000 y1 28.239996 x2 40.500000 y2 27.544268 colour 0 Line x1 39.700001 y1 23.841951 x2 40.299999 y2 24.126341 colour 0 Line x1 39.500000 y1 22.079996 x2 40.500000 y2 22.079996 colour 0 Text3 x1 41.000000 y1 18.299995 colour 0 size 9.600000 c Line x1 40.500000 y1 27.544268 x2 41.500000 y2 26.352673 colour 0 Line x1 40.700001 y1 24.126341 x2 41.299999 y2 24.351051 colour 0 Line x1 40.500000 y1 22.079996 x2 41.500000 y2 22.079996 colour 0 Text3 x1 42.000000 y1 18.299995 colour 0 size 9.600000 a Line x1 41.500000 y1 26.352673 x2 42.500000 y2 26.992168 colour 0 Line x1 41.700001 y1 24.351051 x2 42.299999 y2 24.436800 colour 0 Line x1 41.500000 y1 22.079996 x2 42.500000 y2 22.079996 colour 0 Text3 x1 43.000000 y1 18.299995 colour 0 size 9.600000 g Line x1 42.500000 y1 26.992168 x2 43.500000 y2 28.099997 colour 0 Line x1 42.700001 y1 24.436800 x2 43.299999 y2 24.436804 colour 0 Line x1 42.500000 y1 22.079996 x2 43.500000 y2 22.079996 colour 0 Text3 x1 44.000000 y1 18.299995 colour 0 size 9.600000 a Line x1 43.500000 y1 28.099997 x2 44.500000 y2 27.266476 colour 0 Line x1 43.700001 y1 24.436804 x2 44.299999 y2 24.455681 colour 0 Line x1 43.500000 y1 22.079996 x2 44.500000 y2 22.079996 colour 0 Text3 x1 45.000000 y1 18.299995 colour 0 size 9.600000 t Line x1 44.500000 y1 27.266476 x2 45.500000 y2 27.337500 colour 0 Line x1 44.700001 y1 24.455681 x2 45.299999 y2 24.478352 colour 0 Line x1 44.500000 y1 22.079996 x2 45.500000 y2 22.079996 colour 0 Text3 x1 46.000000 y1 18.299995 colour 0 size 9.600000 c Line x1 45.500000 y1 27.337500 x2 46.500000 y2 27.544266 colour 0 Line x1 45.700001 y1 24.478352 x2 46.299999 y2 24.473017 colour 0 Line x1 45.500000 y1 22.079996 x2 46.500000 y2 22.079996 colour 0 Text3 x1 47.000000 y1 18.299995 colour 0 size 9.600000 c Line x1 46.500000 y1 27.544266 x2 47.500000 y2 27.544266 colour 0 Line x1 46.700001 y1 24.473017 x2 47.299999 y2 24.396658 colour 0 Line x1 46.500000 y1 22.079996 x2 47.500000 y2 22.079996 colour 0 Text3 x1 48.000000 y1 18.299995 colour 0 size 9.600000 t Line x1 47.500000 y1 27.544266 x2 48.500000 y2 27.337502 colour 0 Line x1 47.700001 y1 24.396658 x2 48.299999 y2 24.241009 colour 0 Line x1 47.500000 y1 22.079996 x2 48.500000 y2 22.079996 colour 0 Text3 x1 49.000000 y1 18.299995 colour 0 size 9.600000 g Line x1 48.500000 y1 27.337502 x2 49.500000 y2 27.337500 colour 0 Line x1 48.700001 y1 24.241009 x2 49.299999 y2 24.069206 colour 0 Line x1 48.500000 y1 22.079996 x2 49.500000 y2 22.079996 colour 0 Text3 x1 50.000000 y1 18.299995 colour 0 size 9.600000 g Line x1 49.500000 y1 27.337500 x2 50.500000 y2 28.239994 colour 0 Line x1 49.700001 y1 24.069206 x2 50.299999 y2 23.893618 colour 0 Line x1 49.500000 y1 22.079996 x2 50.500000 y2 22.079996 colour 0 Text3 x1 51.000000 y1 18.299995 colour 0 size 9.600000 a Line x1 50.500000 y1 28.239994 x2 51.500000 y2 28.590889 colour 0 Line x1 50.700001 y1 23.893618 x2 51.299999 y2 23.721315 colour 0 Line x1 50.500000 y1 22.079996 x2 51.500000 y2 22.079996 colour 0 Text3 x1 52.000000 y1 18.299995 colour 0 size 9.600000 c Line x1 51.500000 y1 28.590889 x2 52.500000 y2 28.590889 colour 0 Line x1 51.700001 y1 23.721315 x2 52.299999 y2 23.592623 colour 0 Line x1 51.500000 y1 22.079996 x2 52.500000 y2 22.079996 colour 0 | 
| ##Graphic ##Screen x1 -1.000000 y1 0.000000 x2 60.000000 y2 80.000000 Text3 x1 3.000000 y1 56.099998 colour 0 size 9.600000 c Line x1 2.500000 y1 66.390892 x2 3.500000 y2 66.743393 colour 0 Line x1 2.700000 y1 61.392624 x2 3.300000 y2 61.275398 colour 0 Line x1 2.500000 y1 59.879997 x2 3.500000 y2 59.879997 colour 0 Text3 x1 4.000000 y1 56.099998 colour 0 size 9.600000 c Line x1 3.500000 y1 66.743393 x2 4.500000 y2 67.439995 colour 0 Line x1 3.700000 y1 61.275398 x2 4.300000 y2 61.149536 colour 0 Line x1 3.500000 y1 59.879997 x2 4.500000 y2 59.879997 colour 0 Text3 x1 5.000000 y1 56.099998 colour 0 size 9.600000 a Line x1 4.500000 y1 67.439995 x2 5.500000 y2 66.743401 colour 0 Line x1 4.700000 y1 61.149536 x2 5.300000 y2 61.106289 colour 0 Line x1 4.500000 y1 59.879997 x2 5.500000 y2 59.879997 colour 0 Text3 x1 6.000000 y1 56.099998 colour 0 size 9.600000 t Line x1 5.500000 y1 66.743401 x2 6.500000 y2 66.390892 colour 0 Line x1 5.700000 y1 61.106289 x2 6.300000 y2 61.153755 colour 0 Line x1 5.500000 y1 59.879997 x2 6.500000 y2 59.879997 colour 0 Text3 x1 7.000000 y1 56.099998 colour 0 size 9.600000 g Line x1 6.500000 y1 66.390892 x2 7.500000 y2 66.390892 colour 0 Line x1 6.700000 y1 61.153755 x2 7.300000 y2 61.233425 colour 0 Line x1 6.500000 y1 59.879997 x2 7.500000 y2 59.879997 colour 0 Text3 x1 8.000000 y1 56.099998 colour 0 size 9.600000 g Line x1 7.500000 y1 66.390892 x2 8.500000 y2 66.672783 colour 0 Line x1 7.700000 y1 61.233425 x2 8.300000 y2 61.397869 colour 0 Line x1 7.500000 y1 59.879997 x2 8.500000 y2 59.879997 colour 0 Text3 x1 9.000000 y1 56.099998 colour 0 size 9.600000 g Line x1 8.500000 y1 66.672783 x2 9.500000 y2 66.534241 colour 0 Line x1 8.700000 y1 61.397869 x2 9.300000 y2 61.571949 colour 0 Line x1 8.500000 y1 59.879997 x2 9.500000 y2 59.879997 colour 0 Text3 x1 10.000000 y1 56.099998 colour 0 size 9.600000 t Line x1 9.500000 y1 66.534241 x2 10.500000 y2 64.926659 colour 0 Line x1 9.700000 y1 61.571949 x2 10.300000 y2 61.715958 colour 0 Line x1 9.500000 y1 59.879997 x2 10.500000 y2 59.879997 colour 0 Text3 x1 11.000000 y1 56.099998 colour 0 size 9.600000 g Line x1 10.500000 y1 64.926659 x2 11.500000 y2 64.079994 colour 0 Line x1 10.700000 y1 61.715958 x2 11.300000 y2 61.911022 colour 0 Line x1 10.500000 y1 59.879997 x2 11.500000 y2 59.879997 colour 0 Text3 x1 12.000000 y1 56.099998 colour 0 size 9.600000 t Line x1 11.500000 y1 64.079994 x2 12.500000 y2 64.926659 colour 0 Line x1 11.700000 y1 61.911022 x2 12.300000 y2 62.111980 colour 0 Line x1 11.500000 y1 59.879997 x2 12.500000 y2 59.879997 colour 0 Text3 x1 13.000000 y1 56.099998 colour 0 size 9.600000 a Line x1 12.500000 y1 64.926659 x2 13.500000 y2 66.604996 colour 0 Line x1 12.700000 y1 62.111980 x2 13.300000 y2 62.277496 colour 0 Line x1 12.500000 y1 59.879997 x2 13.500000 y2 59.879997 colour 0 Text3 x1 14.000000 y1 56.099998 colour 0 size 9.600000 c Line x1 13.500000 y1 66.604996 x2 14.500000 y2 66.674149 colour 0 Line x1 13.700000 y1 62.277496 x2 14.300000 y2 62.375381 colour 0 Line x1 13.500000 y1 59.879997 x2 14.500000 y2 59.879997 colour 0 [Part of this file has been deleted for brevity] Text3 x1 39.000000 y1 18.299995 colour 0 size 9.600000 g Line x1 38.500000 y1 30.619995 x2 39.500000 y2 29.439163 colour 0 Line x1 38.700001 y1 26.183289 x2 39.299999 y2 25.984795 colour 0 Line x1 38.500000 y1 22.079996 x2 39.500000 y2 22.079996 colour 0 Text3 x1 40.000000 y1 18.299995 colour 0 size 9.600000 c Line x1 39.500000 y1 29.439163 x2 40.500000 y2 27.337500 colour 0 Line x1 39.700001 y1 25.984795 x2 40.299999 y2 25.732313 colour 0 Line x1 39.500000 y1 22.079996 x2 40.500000 y2 22.079996 colour 0 Text3 x1 41.000000 y1 18.299995 colour 0 size 9.600000 t Line x1 40.500000 y1 27.337500 x2 41.500000 y2 27.693478 colour 0 Line x1 40.700001 y1 25.732313 x2 41.299999 y2 25.440315 colour 0 Line x1 40.500000 y1 22.079996 x2 41.500000 y2 22.079996 colour 0 Text3 x1 42.000000 y1 18.299995 colour 0 size 9.600000 c Line x1 41.500000 y1 27.693478 x2 42.500000 y2 28.174629 colour 0 Line x1 41.700001 y1 25.440315 x2 42.299999 y2 25.244444 colour 0 Line x1 41.500000 y1 22.079996 x2 42.500000 y2 22.079996 colour 0 Text3 x1 43.000000 y1 18.299995 colour 0 size 9.600000 c Line x1 42.500000 y1 28.174629 x2 43.500000 y2 27.399994 colour 0 Line x1 42.700001 y1 25.244444 x2 43.299999 y2 25.109406 colour 0 Line x1 42.500000 y1 22.079996 x2 43.500000 y2 22.079996 colour 0 Text3 x1 44.000000 y1 18.299995 colour 0 size 9.600000 c Line x1 43.500000 y1 27.399994 x2 44.500000 y2 30.461620 colour 0 Line x1 43.700001 y1 25.109406 x2 44.299999 y2 24.874926 colour 0 Line x1 43.500000 y1 22.079996 x2 44.500000 y2 22.079996 colour 0 Text3 x1 45.000000 y1 18.299995 colour 0 size 9.600000 g Line x1 44.500000 y1 30.461620 x2 45.500000 y2 31.206211 colour 0 Line x1 44.700001 y1 24.874926 x2 45.299999 y2 24.621588 colour 0 Line x1 44.500000 y1 22.079996 x2 45.500000 y2 22.079996 colour 0 Text3 x1 46.000000 y1 18.299995 colour 0 size 9.600000 g Line x1 45.500000 y1 31.206211 x2 46.500000 y2 29.220516 colour 0 Line x1 45.700001 y1 24.621588 x2 46.299999 y2 24.433865 colour 0 Line x1 45.500000 y1 22.079996 x2 46.500000 y2 22.079996 colour 0 Text3 x1 47.000000 y1 18.299995 colour 0 size 9.600000 c Line x1 46.500000 y1 29.220516 x2 47.500000 y2 28.734238 colour 0 Line x1 46.700001 y1 24.433865 x2 47.299999 y2 24.306046 colour 0 Line x1 46.500000 y1 22.079996 x2 47.500000 y2 22.079996 colour 0 Text3 x1 48.000000 y1 18.299995 colour 0 size 9.600000 a Line x1 47.500000 y1 28.734238 x2 48.500000 y2 27.402800 colour 0 Line x1 47.500000 y1 22.079996 x2 48.500000 y2 22.079996 colour 0 Text3 x1 49.000000 y1 18.299995 colour 0 size 9.600000 c Line x1 48.500000 y1 27.402800 x2 49.500000 y2 27.756945 colour 0 Line x1 48.500000 y1 22.079996 x2 49.500000 y2 22.079996 colour 0 Text3 x1 50.000000 y1 18.299995 colour 0 size 9.600000 a Line x1 49.500000 y1 27.756945 x2 50.500000 y2 29.081196 colour 0 Line x1 49.500000 y1 22.079996 x2 50.500000 y2 22.079996 colour 0 Text3 x1 51.000000 y1 18.299995 colour 0 size 9.600000 g Line x1 50.500000 y1 29.081196 x2 51.500000 y2 28.872778 colour 0 Line x1 50.500000 y1 22.079996 x2 51.500000 y2 22.079996 colour 0 Text3 x1 52.000000 y1 18.299995 colour 0 size 9.600000 t Line x1 51.500000 y1 28.872778 x2 52.500000 y2 30.866421 colour 0 Line x1 51.500000 y1 22.079996 x2 52.500000 y2 22.079996 colour 0 | 
| ##Graphic ##Screen x1 -1.000000 y1 0.000000 x2 60.000000 y2 80.000000 Text3 x1 3.000000 y1 56.099998 colour 0 size 9.600000 g Line x1 2.500000 y1 68.666420 x2 3.500000 y2 69.829376 colour 0 Line x1 2.500000 y1 59.879997 x2 3.500000 y2 59.879997 colour 0 Text3 x1 4.000000 y1 56.099998 colour 0 size 9.600000 g Line x1 3.500000 y1 69.829376 x2 4.500000 y2 67.101669 colour 0 Line x1 3.500000 y1 59.879997 x2 4.500000 y2 59.879997 colour 0 Text3 x1 5.000000 y1 56.099998 colour 0 size 9.600000 c Line x1 4.500000 y1 67.101669 x2 5.500000 y2 64.516327 colour 0 Line x1 4.500000 y1 59.879997 x2 5.500000 y2 59.879997 colour 0 Text3 x1 6.000000 y1 56.099998 colour 0 size 9.600000 t Line x1 5.500000 y1 64.516327 x2 6.500000 y2 64.659561 colour 0 Line x1 5.500000 y1 59.879997 x2 6.500000 y2 59.879997 colour 0 Text3 x1 7.000000 y1 56.099998 colour 0 size 9.600000 t Line x1 6.500000 y1 64.659561 x2 7.500000 y2 65.344269 colour 0 Line x1 6.500000 y1 59.879997 x2 7.500000 y2 59.879997 colour 0 Text3 x1 8.000000 y1 56.099998 colour 0 size 9.600000 c Line x1 7.500000 y1 65.344269 x2 8.500000 y2 66.555519 colour 0 Line x1 7.500000 y1 59.879997 x2 8.500000 y2 59.879997 colour 0 Text3 x1 9.000000 y1 56.099998 colour 0 size 9.600000 a Line x1 8.500000 y1 66.555519 x2 9.500000 y2 69.829376 colour 0 Line x1 8.500000 y1 59.879997 x2 9.500000 y2 59.879997 colour 0 Text3 x1 10.000000 y1 56.099998 colour 0 size 9.600000 g Line x1 9.500000 y1 69.829376 x2 10.500000 y2 68.666420 colour 0 Line x1 9.500000 y1 59.879997 x2 10.500000 y2 59.879997 colour 0 Text3 x1 11.000000 y1 56.099998 colour 0 size 9.600000 c Line x1 10.500000 y1 68.666420 x2 11.500000 y2 66.672775 colour 0 Line x1 10.500000 y1 59.879997 x2 11.500000 y2 59.879997 colour 0 Text3 x1 12.000000 y1 56.099998 colour 0 size 9.600000 c Line x1 11.500000 y1 66.672775 x2 12.500000 y2 66.881195 colour 0 Line x1 11.500000 y1 59.879997 x2 12.500000 y2 59.879997 colour 0 Text3 x1 13.000000 y1 56.099998 colour 0 size 9.600000 a Line x1 12.500000 y1 66.881195 x2 13.500000 y2 66.110931 colour 0 Line x1 12.500000 y1 59.879997 x2 13.500000 y2 59.879997 colour 0 Text3 x1 14.000000 y1 56.099998 colour 0 size 9.600000 c Line x1 13.500000 y1 66.110931 x2 14.500000 y2 64.720856 colour 0 Line x1 13.500000 y1 59.879997 x2 14.500000 y2 59.879997 colour 0 Text3 x1 15.000000 y1 56.099998 colour 0 size 9.600000 t Line x1 14.500000 y1 64.720856 x2 15.500000 y2 64.720856 colour 0 Line x1 14.500000 y1 59.879997 x2 15.500000 y2 59.879997 colour 0 Text3 x1 16.000000 y1 56.099998 colour 0 size 9.600000 t Line x1 15.500000 y1 64.720856 x2 16.500000 y2 66.534241 colour 0 Line x1 15.500000 y1 59.879997 x2 16.500000 y2 59.879997 colour 0 Text3 x1 17.000000 y1 56.099998 colour 0 size 9.600000 g Line x1 16.500000 y1 66.534241 x2 17.500000 y2 66.672775 colour 0 Line x1 16.500000 y1 59.879997 x2 17.500000 y2 59.879997 colour 0 Text3 x1 18.000000 y1 56.099998 colour 0 size 9.600000 t Line x1 17.500000 y1 66.672775 x2 18.500000 y2 59.879997 colour 0 Line x1 17.500000 y1 59.879997 x2 18.500000 y2 59.879997 colour 0 Text3 x1 19.000000 y1 56.099998 colour 0 size 9.600000 g Line x1 18.500000 y1 59.879997 x2 19.500000 y2 59.879997 colour 0 Line x1 18.500000 y1 59.879997 x2 19.500000 y2 59.879997 colour 0 Text3 x1 20.000000 y1 56.099998 colour 0 size 9.600000 a Line x1 19.500000 y1 59.879997 x2 20.500000 y2 59.879997 colour 0 | 
The data file consists of three columns separated by blanks or tab characters.
The first column is the sequence.  
 
The second column is the local bending.
The third is the curvature. 
The description of this bending model is as follows:
The roll-tilt-twist parameters of this model are derived purely from experimental observations of sequence location preferences of base trimers in small circles of DNA, without reference to solution techniques that measure curvature per se. For this reason, they may be the most objective and unbiased parameters of all. Satchwell, Drew and Travers studied the positioning of DNA sequences wrappped around nucleosome cores, and in closed circles of double-helical DNA of comparable size. From the sequence data they calculated a fractional preference of each base pair triplet for a position 'facing out', or with the major groove on the concave side of the curved helix. The sequence GGC, for example, has a 45% preference for locations on a bent double helix in which its major groove faces inward and is compressed by the curvature (tending towards positive roll), whereas sequence AAA has a 36% preference for the opposite orientation, with major groove facing outward and with minor groove facing inward and compressed (tending toward negative roll). These fractional variances have been converted into roll angles in the following manner: Because x-ray cyrstal structure analysis uniformly indicates that AA steps are unbent, a zero roll is assigned to the AAA triplet; an arbitrary maximum roll of 10 degrees is asigned to GGC, and all other triplets are scaled in a lenear manner. Where % is the percent-out figure, then:
         Roll = 10 degrees * (% + 36)/(45 + 36)
Changing the maximum roll value will scale the entire profile up or down proportionately, but will not change the shape of the profile. Peaks will remain peaks, and valleys, valleys. The absolute magnitide of all the roll values is less important than their relative magnitude, or the order of roll preference. Twist angles were set to zero. Because these values correspond to base trimers, the values of roll, tilt and twist were applied to the first two bases for the calculation.
DNA bending is vital for the winding of DNA in nucleosomes, and the recognition of particular DNA loci by restriction enzymes, repressors and other control proteins. For example, the binding of the catabolite gene activator protein and of the TATA-box recognition protein to a double DNA helix both rely on major bends in the helix induced at specific sequence loci. Whether the particular recognition sequences are bent even in the absence of proteins is not always clear: a preformed bend in the DNA would form a custom site for protein binding, or an enhanced bendability of a given sequence would facilitate protein-induced bending. Sadly, the rules of sequence-dependent DNA bending remain elusive.
Two models of sequence-dependent bending in free DNA have been proposed. Nearest neighbor models propose that large-scale measurable curvature may arise by the accumulation of many small local deformations in helical twist, roll, tilt and slide at individual steps between base pairs. In contrast, junction models propose that bending occurs at the interface between two different structural variants of the B-DNA double helix.
In both models, sequences which are anisotropically bendable - for instance, sequences with steps that preferentially bend only to compress the major groove - will lead to an average structure which is similar to a sequence with a rigid, intrinsic bend. The default bending model (see below) used by banana does not distinguish between these two possibilities.
B-DNA has the special property of having its base pairs very nearly perpendicular to the overall helix axis. Hence the normal vector to each base pair can be taken as representing the local helix at that point, and curvature and bending can be studied simply by observing the behaviour of the normal vectors from one base to another along the helix. This is both easy to calculate and simple to interpret. This program display the magnitude of bending and curvature at each point along the sequence. It is not intended as a substitute for more elaborate three-dimensional trajectory calculations, but only to express bending tendencies as a function of sequence. This affords easy screening for regions of a given DNA sequence where phased local bends add constructively to form an overall curve.
The terms bending and curvature are used in a restricted sense here. Bending of DNA describes the tendency for successive base pairs to be non-parallel in an additive manner over several base pair steps. Bending most commonly is produced by a rolling of adjacent base pairs over one another about thir long axis, although in principle, tilting of base pairs about their short axis could make a contribution. In contrast curvature of DNA represents the tendency of the helix axis to follow a non-linear pathway over an appreciable length, in a manner that contributes to macroscopic behaviour such as gel retardation or ease of cyclization into DNA minicircles.
The distinction between local bending and macroscopic curvature is illustrated (poorly) in the following figure (see figure 1 of the Goodsell & Dickerson paper for a better view).
                       bend   bend   bend
                         -     -     -
  uncurved              / \   / \   / \
                  -----/   \-/   \-/   \-----
                          bend   bend
                  
                      
                    bend    bend
                     /-------\
                   /          \
  curved          |bend        |bend
                  |            |
                  |            |
X-ray crystal structure analysis cannot show curvature, but can and often does show local bending. Conversely, gel electrophoresis and cyclization kinetics can detect macroscopic curvature, but not bending. A complete knowledge of local bending would permit the precise calculation of curvature, but a knowledge of macroscopic curvature alone does not allow one to specify precisely the local bending elements that produce it. This paradox has plagued the DNA conformation field resembles the familiar problem of classical statistical mechanics, where a complete knowledge of positions and velocities of all molecules of a gas would allow one to calculate bulk properties such as temperature, pressure and volume, but knowledge of bulk properties cannot lead one to precise molecular positions. Many molecular arrangements can produce identical bulk properties, and in the present case, many bending combinations can produce identical macroscopic curvature.
The consensus sequence for DNA bending is 5 As and 5 non-As alternating. "N" is an ambiguity code for any base, and "B" is the ambiguity code for "not A" so "BANANA" is itself a bent sequence - hence the name of this program.
| Program name | Description | 
|---|---|
| btwisted | Calculate the twisting in a B-DNA sequence | 
| chaos | Draw a chaos game representation plot for a nucleotide sequence | 
| compseq | Calculate the composition of unique words in sequences | 
| dan | Calculates nucleic acid melting temperature | 
| density | Draw a nucleic acid density plot | 
| einverted | Finds inverted repeats in nucleotide sequences | 
| freak | Generate residue/base frequency table or plot | 
| isochore | Plots isochores in DNA sequences | 
| sirna | Finds siRNA duplexes in mRNA | 
| wordcount | Count and extract unique words in molecular sequence(s) | 
Please report all bugs to the EMBOSS bug team (emboss-bug © emboss.open-bio.org) not to the original author.