From fungazid at yahoo.com Mon Jan 11 09:26:34 2010 From: fungazid at yahoo.com (Fungazid) Date: Mon, 11 Jan 2010 06:26:34 -0800 (PST) Subject: [EMBOSS] getorf includes unspecified amino acids as part of the ORF sequence Message-ID: <480812.49255.qm@web65508.mail.ac4.yahoo.com> Hello people, I just installed emboss on linux ubuntu (using the ubuntu synaptic package manager). I am using the getorf program, and I see it gives me this kind of output lines: >00001_3 [803 - 1120] LARLRFVVLGNSFIASAKGWSTPYGPTTFGPFRSCIYPRVFRSTRVRKAMATRIGSNRVN ILIRCTXXXXXXXXXXXXXXXXXXXXXXXXXNPYLGWWCYIFCIFR I don't like the Xs as they represent unspecified amino acids. Is there an input parameter to tell the program to report only the regions before and after the Xs ? In addition (and maybe this is beyond the scope of this mailing list) what is the biological meaning of such Xs ? thanks, Avi From biopython at maubp.freeserve.co.uk Mon Jan 11 10:53:02 2010 From: biopython at maubp.freeserve.co.uk (Peter) Date: Mon, 11 Jan 2010 15:53:02 +0000 Subject: [EMBOSS] getorf includes unspecified amino acids as part of the ORF sequence In-Reply-To: <480812.49255.qm@web65508.mail.ac4.yahoo.com> References: <480812.49255.qm@web65508.mail.ac4.yahoo.com> Message-ID: <320fb6e01001110753s6c2f9939i7e4a619896794007@mail.gmail.com> On Mon, Jan 11, 2010 at 2:26 PM, Fungazid wrote: > > Hello people, > > I just installed emboss on linux ubuntu (using the ubuntu synaptic package manager). I am using the getorf program, and I see it gives me this kind of output lines: > >>00001_3 [803 - 1120] > LARLRFVVLGNSFIASAKGWSTPYGPTTFGPFRSCIYPRVFRSTRVRKAMATRIGSNRVN > ILIRCTXXXXXXXXXXXXXXXXXXXXXXXXXNPYLGWWCYIFCIFR > > I don't like the Xs as they represent unspecified amino acids. Is there an input parameter to tell the program to report only the regions before and after the Xs ? > > In addition (and maybe this is beyond the scope of this mailing list) what is the biological meaning of such Xs ? What was the input sequence like? Was there a stretch of NNNNN perhaps? Peter From fungazid at yahoo.com Tue Jan 12 08:33:14 2010 From: fungazid at yahoo.com (Fungazid) Date: Tue, 12 Jan 2010 05:33:14 -0800 (PST) Subject: [EMBOSS] getorf includes unspecified amino acids as part of the ORF sequence In-Reply-To: <320fb6e01001110753s6c2f9939i7e4a619896794007@mail.gmail.com> References: <480812.49255.qm@web65508.mail.ac4.yahoo.com> <320fb6e01001110753s6c2f9939i7e4a619896794007@mail.gmail.com> Message-ID: <488158.80632.qm@web65501.mail.ac4.yahoo.com> Hi Peter, The input is a simple?fasta file with only A,C,T,G letters and nothing else, so I wouldn't expect any Xs. In addition, even if there?would be?Ns (and there are no Ns) the program cannot know if such Ns do not include stop codons so it should not consider them as part of an?ORF. Best, Avi ----- Original Message ---- From: Peter To: Fungazid Cc: emboss at lists.open-bio.org Sent: Mon, January 11, 2010 5:53:02 PM Subject: Re: [EMBOSS] getorf includes unspecified amino acids as part of the ORF sequence On Mon, Jan 11, 2010 at 2:26 PM, Fungazid wrote: > > Hello people, > > I just installed emboss on linux ubuntu (using the ubuntu synaptic package manager). I am using the getorf program, and I see it gives me this kind of output lines: > >>00001_3 [803 - 1120] > LARLRFVVLGNSFIASAKGWSTPYGPTTFGPFRSCIYPRVFRSTRVRKAMATRIGSNRVN > ILIRCTXXXXXXXXXXXXXXXXXXXXXXXXXNPYLGWWCYIFCIFR > > I don't like the Xs as they represent unspecified amino acids. Is there an input parameter to tell the program to report only the regions before and after the Xs ? > > In addition (and maybe this is beyond the scope of this mailing list) what is the biological meaning of such Xs ? What was the input sequence like? Was there a stretch of NNNNN perhaps? Peter From pmr at ebi.ac.uk Tue Jan 12 09:15:28 2010 From: pmr at ebi.ac.uk (Peter Rice) Date: Tue, 12 Jan 2010 14:15:28 +0000 Subject: [EMBOSS] getorf includes unspecified amino acids as part of the ORF sequence In-Reply-To: <488158.80632.qm@web65501.mail.ac4.yahoo.com> References: <480812.49255.qm@web65508.mail.ac4.yahoo.com> <320fb6e01001110753s6c2f9939i7e4a619896794007@mail.gmail.com> <488158.80632.qm@web65501.mail.ac4.yahoo.com> Message-ID: <4B4C8400.3080602@ebi.ac.uk> Hi Avi, > The input is a simple fasta file with only A,C,T,G letters and > nothing else, so I wouldn't expect any Xs. In addition, even if there > would be Ns (and there are no Ns) the program cannot know if such Ns > do not include stopcodons so it should not consider them as part of an ORF. >>> 00001_3 [803 - 1120] >> LARLRFVVLGNSFIASAKGWSTPYGPTTFGPFRSCIYPRVFRSTRVRKAMATRIGSNRVN >> ILIRCTXXXXXXXXXXXXXXXXXXXXXXXXXNPYLGWWCYIFCIFR That suggests the Xs have all come from stop codons. There are other possibilities, including a badly formatted input file (perhaps two sequences and descriptions read as one). We do need to see the input file to know where those Xs are from. Peter Rice From fungazid at yahoo.com Wed Jan 13 11:30:26 2010 From: fungazid at yahoo.com (Fungazid) Date: Wed, 13 Jan 2010 08:30:26 -0800 (PST) Subject: [EMBOSS] getorf includes unspecified amino acids as part of the ORF sequence In-Reply-To: <4B4C8400.3080602@ebi.ac.uk> References: <480812.49255.qm@web65508.mail.ac4.yahoo.com> <320fb6e01001110753s6c2f9939i7e4a619896794007@mail.gmail.com> <488158.80632.qm@web65501.mail.ac4.yahoo.com> <4B4C8400.3080602@ebi.ac.uk> Message-ID: <3651.97395.qm@web65505.mail.ac4.yahoo.com> Thanks Peter, I made a mistake and took a repeat masked contigs instead of the original contigs, and they indeed had Ns. Sorry for the mess (still, I?am looking for an option where Ns are not be included in?the ORF). Avi ----- Original Message ---- From: Peter Rice To: Fungazid Cc: emboss at lists.open-bio.org Sent: Tue, January 12, 2010 4:15:28 PM Subject: Re: [EMBOSS] getorf includes unspecified amino acids as part of the ORF sequence Hi Avi, > The input is a simple fasta file with only A,C,T,G letters and > nothing else, so I wouldn't expect any Xs. In addition, even if there > would be Ns (and there are no Ns) the program cannot know if such Ns > do not include stopcodons so it should not consider them as part of an ORF. >>> 00001_3 [803 - 1120] >> LARLRFVVLGNSFIASAKGWSTPYGPTTFGPFRSCIYPRVFRSTRVRKAMATRIGSNRVN >> ILIRCTXXXXXXXXXXXXXXXXXXXXXXXXXNPYLGWWCYIFCIFR That suggests the Xs have all come from stop codons. There are other possibilities, including a badly formatted input file (perhaps two sequences and descriptions read as one). We do need to see the input file to know where those Xs are from. Peter Rice From pmr at ebi.ac.uk Wed Jan 13 12:36:08 2010 From: pmr at ebi.ac.uk (Peter Rice) Date: Wed, 13 Jan 2010 17:36:08 +0000 Subject: [EMBOSS] getorf includes unspecified amino acids as part of the ORF sequence In-Reply-To: <3651.97395.qm@web65505.mail.ac4.yahoo.com> References: <480812.49255.qm@web65508.mail.ac4.yahoo.com> <320fb6e01001110753s6c2f9939i7e4a619896794007@mail.gmail.com> <488158.80632.qm@web65501.mail.ac4.yahoo.com> <4B4C8400.3080602@ebi.ac.uk> <3651.97395.qm@web65505.mail.ac4.yahoo.com> Message-ID: <4B4E0488.1070409@ebi.ac.uk> Hi Avi, > I made a mistake and took a repeat masked contigs instead of the > original contigs, and they indeed had Ns. Sorry for the mess (still, > I am looking for an option where Ns are not be included in the ORF). Just too late for the next EMBOSS release (in preparation), but a good suggestion for July. We should look at adding options to all the translation programs for repeat-masked inputs. This probably means treating each unmasked (non N) region as a separate sequence with options to include an OREF running up to the Ns or to stop at the last stop codon, and the same for the start of an ORF. Similar to handling the start and end of the whole sequence. Hope that will help Peter From ajb at ebi.ac.uk Fri Jan 15 06:59:26 2010 From: ajb at ebi.ac.uk (ajb at ebi.ac.uk) Date: Fri, 15 Jan 2010 11:59:26 -0000 (UTC) Subject: [EMBOSS] EMBOSS 6.2.0 released Message-ID: <47510.86.26.12.63.1263556766.squirrel@webmail.ebi.ac.uk> EMBOSS 6.2.0 is now available. You can download it from our ftp server: ftp://emboss.open-bio.org:/pub/EMBOSS/ Its associated (optional) EMBASSY packages are in the same directory. The native Microsoft windows port (mEMBOSS) can be downloaded from the directory: ftp://emboss.open-bio.org:/pub/EMBOSS/windows/ 6.2.0 is primarily a maintenance release but does contain many new features listed in the attached changelog. Alan -------------- next part -------------- A non-text attachment was scrubbed... Name: changelog Type: application/octet-stream Size: 9007 bytes Desc: not available URL: From biopython at maubp.freeserve.co.uk Fri Jan 15 07:34:32 2010 From: biopython at maubp.freeserve.co.uk (Peter) Date: Fri, 15 Jan 2010 12:34:32 +0000 Subject: [EMBOSS] Many-to-many with needle and water In-Reply-To: <4A51D360.1050107@ebi.ac.uk> References: <320fb6e00907060312l5506c766i1c4a4ff48fba8c7e@mail.gmail.com> <4A51D360.1050107@ebi.ac.uk> Message-ID: <320fb6e01001150434y2ecb268ai460fbf962895d6a6@mail.gmail.com> On Mon, Jul 6, 2009 at 10:35 AM, Peter Rice wrote: > > Peter Cock or biopython wrote: >> Hi Peter R. et al, >> >> I gather EMBOSS is looking for feedback for new applications (given >> the recent funding from the BBSRC - congratulations again). How about >> suggestions for extensions to existing EMBOSS applications? >> >> I've used bits of EMBOSS for several years now (thank you!). Something >> I have sometimes wanted to do is a many-to-many pairwise sequence >> alignment with the EMBOSS tools needle and water. >> >> Right now, needle and water take two files (here referred to as A and >> B), file A has just one sequence, and file B can have one or more >> sequences. I'd like to be able to supply two files both with multiple >> entries, and have needle/water do pairwise alignments between all the >> sequences in A against all the sequences in B. This might be useful >> for finding reciprocal best hits in comparative genomics (as an slower >> but exact alternative to FASTA or BLAST). > > The application is easy to add (after the release) > > The usual problem with all-against-all is that it involves loading one > of the inputs as a sequence set entirely in memory - to avoid reading > one input many times over. > > We have an application supermatcher which does this - the first sequence > is streamed through, the second is a sequence set loaded into memory. It > uses work matching to find seed alignments then runs a limited alignment > around the hits. > > superwater would be a possible name (or superneedle). Is see EMBOSS 6.2 has a new tool "needleall" (although if there is a matching "waterall" the changelog doesn't mention it): http://lists.open-bio.org/pipermail/emboss/2010-January/003823.html I'll have to try this out... Peter From ajb at ebi.ac.uk Wed Jan 20 10:21:20 2010 From: ajb at ebi.ac.uk (ajb at ebi.ac.uk) Date: Wed, 20 Jan 2010 15:21:20 -0000 (UTC) Subject: [EMBOSS] mEMBOSS 6.2.0.1 available Message-ID: <54507.86.26.12.63.1264000880.squirrel@webmail.ebi.ac.uk> mEMBOSS 6.0.2.1 is available from: ftp://emboss.open-bio.org/pub/EMBOSS/windows/ It fixes a library problem that prevented emma from launching clustal. There are also a few minor updates. Alan